Recombinant Full Length Human ALPP Protein, C-Flag-tagged
Cat.No. : | ALPP-150HFL |
Product Overview : | Recombinant Full Length Human ALPP Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is an alkaline phosphatase, a metalloenzyme that catalyzes the hydrolysis of phosphoric acid monoesters. It belongs to a multigene family composed of four alkaline phosphatase isoenzymes. The enzyme functions as a homodimer and has a catalytic site containing one magnesium and two zinc ions, which are required for its enzymatic function. One of the main sources of this enzyme is the liver, and thus, it's one of several indicators of liver injury in different clinical conditions. In pregnant women, this protein is primarily expressed in placental and endometrial tissue, however, strong ectopic expression has been detected in ovarian adenocarcinoma, serous cystadenocarcinoma, and other ovarian cancer cells. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 55.5 kDa |
AA Sequence : | MLGPCMLLLLLLLGLRLQLSLGIIPVEEENPDFWNREAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVST VTAARILKGQKKDKLGPEIPLAMDRFPYVALSKTYNVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARF NQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIAT QLISNMDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASL DPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRAL TETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPG YVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVAVFARGPQAHLVHGVQEQTFIAHVMAFAACL EPYTACDLAPPAGTTDAAHPGRSVVPALLPLLAGTLLLLETATAPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Folate biosynthesis, Metabolic pathways |
Full Length : | Full L. |
Gene Name | ALPP alkaline phosphatase, placental [ Homo sapiens (human) ] |
Official Symbol | ALPP |
Synonyms | ALP; IAP; ALPI; PALP; PLAP; PLAP-1 |
Gene ID | 250 |
mRNA Refseq | NM_001632.5 |
Protein Refseq | NP_001623.3 |
MIM | 171800 |
UniProt ID | P05187 |
◆ Recombinant Proteins | ||
ALPP-1821H | Recombinant Human ALPP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ALPP-1345C | Recombinant Cynomolgus ALPP protein, His-tagged | +Inquiry |
ALPP-124H | Recombinant Human ALPP Protein, His-tagged | +Inquiry |
ALPP-125H | Recombinant Human ALPP Protein, His-tagged | +Inquiry |
ALPP-302H | Recombinant Human ALPP Protein, His tagged | +Inquiry |
◆ Native Proteins | ||
ALPP-8347H | Native Human ALPP | +Inquiry |
ALPP-8005H | Native Human Placental Alkaline Phosphatase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALPP-8893HCL | Recombinant Human ALPP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALPP Products
Required fields are marked with *
My Review for All ALPP Products
Required fields are marked with *
0
Inquiry Basket