Recombinant Full Length Human ANKRD65 Protein, GST-tagged
| Cat.No. : | ANKRD65-3510HF | 
| Product Overview : | Human hCG_20426 full-length ORF ( ACE87293.1, 1 a.a. - 174 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 174 amino acids | 
| Description : | ANKRD65 (Ankyrin Repeat Domain 65) is a Protein Coding gene. An important paralog of this gene is ANKRD17. | 
| Molecular Mass : | 45.54 kDa | 
| AA Sequence : | MDSQRPEPREEEEEEQELRWMELDSEEALGTRTEGPSVVQGWGHLLQAVWRGPAGLVTQLLRQGASVEETTLRCCWATGQTQASGTGMAALRCTGLPPEDTCLPSSCWSPRGPRWMRGTPWASHPCITPLGKATWRLPAACWTGVPRWMLPAGSERPPYTWLQSEGMGLPWGFC | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | ANKRD65 ankyrin repeat domain 65 [ Homo sapiens (human) ] | 
| Official Symbol | ANKRD65 | 
| Synonyms | ANKRD65; ankyrin repeat domain 65; ankyrin repeat domain-containing protein 65; | 
| Gene ID | 441869 | 
| mRNA Refseq | NM_001145210 | 
| Protein Refseq | NP_001138682 | 
| UniProt ID | E5RJM6 | 
| ◆ Recombinant Proteins | ||
| ANKRD65-3510HF | Recombinant Full Length Human ANKRD65 Protein, GST-tagged | +Inquiry | 
| ANKRD65-3487H | Recombinant Human ANKRD65, His-tagged | +Inquiry | 
| ANKRD65-4624H | Recombinant Human ANKRD65 Protein, GST-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANKRD65 Products
Required fields are marked with *
My Review for All ANKRD65 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            