Recombinant Full Length Human ANKRD65 Protein, GST-tagged

Cat.No. : ANKRD65-3510HF
Product Overview : Human hCG_20426 full-length ORF ( ACE87293.1, 1 a.a. - 174 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 174 amino acids
Description : ANKRD65 (Ankyrin Repeat Domain 65) is a Protein Coding gene. An important paralog of this gene is ANKRD17.
Molecular Mass : 45.54 kDa
AA Sequence : MDSQRPEPREEEEEEQELRWMELDSEEALGTRTEGPSVVQGWGHLLQAVWRGPAGLVTQLLRQGASVEETTLRCCWATGQTQASGTGMAALRCTGLPPEDTCLPSSCWSPRGPRWMRGTPWASHPCITPLGKATWRLPAACWTGVPRWMLPAGSERPPYTWLQSEGMGLPWGFC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ANKRD65 ankyrin repeat domain 65 [ Homo sapiens (human) ]
Official Symbol ANKRD65
Synonyms ANKRD65; ankyrin repeat domain 65; ankyrin repeat domain-containing protein 65;
Gene ID 441869
mRNA Refseq NM_001145210
Protein Refseq NP_001138682
UniProt ID E5RJM6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANKRD65 Products

Required fields are marked with *

My Review for All ANKRD65 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon