Recombinant Full Length Human ANXA3 Protein, C-Flag-tagged
Cat.No. : | ANXA3-1379HFL |
Product Overview : | Recombinant Full Length Human ANXA3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions in the inhibition of phopholipase A2 and cleavage of inositol 1,2-cyclic phosphate to form inositol 1-phosphate. This protein may also play a role in anti-coagulation. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 36.2 kDa |
AA Sequence : | MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSNAQRQLIVKEYQAAYGKELKD DLKGDLSGHFEHLMVALVTPPAVFDAKQLKKSMKGAGTNEDALIEILTTRTSRQMKDISQAYYTVYKKSL GDDISSETSGDFRKALLTLADGRRDESLKVDEHLAKQDAQILYKAGENRWGTDEDKFTEILCLRSFPQLK LTFDEYRNISQKDIVDSIKGELSGHFEDLLLAIVNCVRNTPAFLAERLHRALKGIGTDEFTLNRIMVSRS EIDLLDIRTEFKKHYGYSLYSAIKSDTSGDYEITLLKICGGDD |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Stem cell - Pluripotency |
Full Length : | Full L. |
Gene Name | ANXA3 annexin A3 [ Homo sapiens (human) ] |
Official Symbol | ANXA3 |
Synonyms | ANX3 |
Gene ID | 306 |
mRNA Refseq | NM_005139.3 |
Protein Refseq | NP_005130.1 |
MIM | 106490 |
UniProt ID | P12429 |
◆ Recombinant Proteins | ||
ANXA3-26596TH | Recombinant Human ANXA3 | +Inquiry |
ANXA3-2266H | Recombinant Human ANXA3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ANXA3-583M | Recombinant Mouse ANXA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Anxa3-607M | Recombinant Mouse Anxa3 Protein, MYC/DDK-tagged | +Inquiry |
ANXA3-690R | Recombinant Rat ANXA3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANXA3-8832HCL | Recombinant Human ANXA3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANXA3 Products
Required fields are marked with *
My Review for All ANXA3 Products
Required fields are marked with *
0
Inquiry Basket