Recombinant Full Length Human ANXA4 Protein, C-Flag-tagged
Cat.No. : | ANXA4-1683HFL |
Product Overview : | Recombinant Full Length Human ANXA4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANX4 is almost exclusively expressed in epithelial cells. Several transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 35.9 kDa |
AA Sequence : | MAMATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDL KSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLED DIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHV FDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEI DMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | ANXA4 annexin A4 [ Homo sapiens (human) ] |
Official Symbol | ANXA4 |
Synonyms | ANX4; P32.5; PIG28; PP4-X; ZAP36; PAP-II; HEL-S-274 |
Gene ID | 307 |
mRNA Refseq | NM_001153.5 |
Protein Refseq | NP_001144.1 |
MIM | 106491 |
UniProt ID | P09525 |
◆ Recombinant Proteins | ||
ANXA4-1332D | Recombinant Dog ANXA4 protein, His-tagged | +Inquiry |
ANXA4-339R | Recombinant Rhesus monkey ANXA4 Protein, His-tagged | +Inquiry |
ANXA4-1044HF | Recombinant Full Length Human ANXA4 Protein, GST-tagged | +Inquiry |
ANXA4-167R | Recombinant Rhesus Macaque ANXA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ANXA4-2519H | Recombinant Human ANXA4 protein, His-SUMO & Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANXA4-8831HCL | Recombinant Human ANXA4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANXA4 Products
Required fields are marked with *
My Review for All ANXA4 Products
Required fields are marked with *
0
Inquiry Basket