Recombinant Full Length Human AP1AR Protein, GST-tagged

• Cat.No.: AP1AR-2597HF
• Product Overview: Human C4orf16 full-length ORF (AAH09485.1, 1 a.a. - 269 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 269 amino acids
• Description: AP1AR (Adaptor Related Protein Complex 1 Associated Regulatory Protein) is a Protein Coding gene. GO annotations related to this gene include kinesin binding and AP-1 adaptor complex binding.
• Molecular Mass: 56.9 kDa
• AA Sequence: MGNCCWTQCFGLLRKEAGRLQRVGGGGGSKYFRTCSRGEHLTIEFENLVESDEGESPGSSHRPLTEEEIVDLRERHYDSIAEKQKDLDKKIQKEQERQRIVQQYHPSNNGEYQSSGPEDDFESCLRNMKSQYEVFRSSRLSSDATVLTPNTESSCDLMTKTKSTSGNDDSTSLDLEWEDEEGMNRMLPMRERSKTEEDILRAALKYSNKETGSNPTSASDDSNGLEWENDFVSAEMDDNGNSEYSGFVNPVLELSDSGIRHSDTDQQTR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AP1AR adaptor-related protein complex 1 associated regulatory protein [ Homo sapiens ]
• Official Symbol: AP1AR
• Synonyms: 2C18; GBAR; C4orf16; PRO0971; gamma-BAR
• Gene ID: 55435
• mRNA Refseq: NM_018569
• Protein Refseq: NP_061039
• MIM: 610851
• UniProt ID: Q63HQ0