Recombinant Full Length Human AP2M1 Protein, C-Flag-tagged
Cat.No. : | AP2M1-1375HFL |
Product Overview : | Recombinant Full Length Human AP2M1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a subunit of the heterotetrameric coat assembly protein complex 2 (AP2), which belongs to the adaptor complexes medium subunits family. The encoded protein is required for the activity of a vacuolar ATPase, which is responsible for proton pumping occurring in the acidification of endosomes and lysosomes. The encoded protein may also play an important role in regulating the intracellular trafficking and function of CTLA-4 protein. Three transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 49.2 kDa |
AA Sequence : | MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTK QNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKS QHQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMP ECKFGMNDKIVIEKQGKGTADETSKSGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTT KDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENA IVWKIKRMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIK WVRYIGRSGIYETRCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Endocytosis, Huntington's disease |
Full Length : | Full L. |
Gene Name | AP2M1 adaptor related protein complex 2 subunit mu 1 [ Homo sapiens (human) ] |
Official Symbol | AP2M1 |
Synonyms | mu2; AP50; MRD60; CLAPM1 |
Gene ID | 1173 |
mRNA Refseq | NM_001025205.2 |
Protein Refseq | NP_001020376.1 |
MIM | 601024 |
UniProt ID | Q96CW1 |
◆ Recombinant Proteins | ||
AP2M1-602M | Recombinant Mouse AP2M1 Protein, His (Fc)-Avi-tagged | +Inquiry |
AP2M1-3533C | Recombinant Chicken AP2M1 | +Inquiry |
AP2M1-301C | Recombinant Cynomolgus AP2M1 Protein, His-tagged | +Inquiry |
AP2M1-2694H | Recombinant Human AP2M1 protein, His-tagged | +Inquiry |
AP2M1-701R | Recombinant Rat AP2M1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
AP2M1-8813HCL | Recombinant Human AP2M1 293 Cell Lysate | +Inquiry |
AP2M1-8814HCL | Recombinant Human AP2M1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AP2M1 Products
Required fields are marked with *
My Review for All AP2M1 Products
Required fields are marked with *
0
Inquiry Basket