Recombinant Full Length Human APOBEC3C Protein, C-Flag-tagged

Cat.No. : APOBEC3C-2141HFL
Product Overview : Recombinant Full Length Human APOBEC3C Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 22.6 kDa
AA Sequence : MNPQIRNPMKAMYPGTFYFQFKNLWEANDRDETWLCFTVEGIKRRSVVSWKTGVFRNQVDSETHCHAERC FLSWFCDDILSPNTKYQVTWYTSWSPCPDCAGEVAEFLARHSNVNLTIFTARLYYFQYPCYQEGLRSLSQ EGVAVEIMDYEDFKYCWENFVYNDNEPFKPWKGLKTNFRLLKRRLRESLQ myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Full Length : Full L.
Gene Name APOBEC3C apolipoprotein B mRNA editing enzyme catalytic subunit 3C [ Homo sapiens (human) ]
Official Symbol APOBEC3C
Synonyms A3C; PBI; ARP5; ARDC2; ARDC4; APOBEC1L; bK150C2.3
Gene ID 27350
mRNA Refseq NM_014508.3
Protein Refseq NP_055323.2
MIM 607750
UniProt ID Q9NRW3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All APOBEC3C Products

Required fields are marked with *

My Review for All APOBEC3C Products

Required fields are marked with *

0
cart-icon
0
compare icon