Recombinant Full Length Human APOL3 Protein, C-Flag-tagged
Cat.No. : | APOL3-1778HFL |
Product Overview : | Recombinant Full Length Human APOL3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is a member of the apolipoprotein L gene family, and it is present in a cluster with other family members on chromosome 22. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids, including cholesterol, and/or allow the binding of lipids to organelles. In addition, expression of this gene is up-regulated by tumor necrosis factor-alpha in endothelial cells lining the normal and atherosclerotic iliac artery and aorta. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 36.4 kDa |
AA Sequence : | MDSEKKRFTEEATKYFRERVSPVHLQILLTNNEAWKRFVTAAELPRDEADALYEALKKLRTYAAIEDEYV QQKDEQFREWFLKEFPQVKRKIQESIEKLRALANGIEEVHRGCTISNVVSSSTGAASGIMSLAGLVLAPF TAGTSLALTAAGVGLGAASAVTGITTSIVEHSYTSSAEAEASRLTATSIDRLKVFKEVMRDITPNLLSLL NNYYEATQTIGSEIRAIRQARARARLPVTTWRISAGSGGQAERTIAGTTRAVSRGARILSATTSGIFLAL DVVNLVYESKHLHEGAKSASAEELRRQAQELEENLMELTQIYQRLNPCHTH myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | APOL3 apolipoprotein L3 [ Homo sapiens (human) ] |
Official Symbol | APOL3 |
Synonyms | CG121; CG12_1; APOLIII; apoL-III |
Gene ID | 80833 |
mRNA Refseq | NM_145641.3 |
Protein Refseq | NP_663616.1 |
MIM | 607253 |
UniProt ID | O95236 |
◆ Recombinant Proteins | ||
APOL3-713H | Recombinant Human APOL3 protein, GST-tagged | +Inquiry |
APOL3-3731H | Recombinant Human APOL3 protein, His-tagged | +Inquiry |
APOL3-750HFL | Recombinant Full Length Human APOL3 Protein, N-GST/C-His-tagged | +Inquiry |
APOL3-3576H | Recombinant Human APOL3, His-tagged | +Inquiry |
APOL3-472H | Recombinant Human APOL3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOL3-8776HCL | Recombinant Human APOL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APOL3 Products
Required fields are marked with *
My Review for All APOL3 Products
Required fields are marked with *
0
Inquiry Basket