Recombinant Full Length Human AQP1 Protein, C-Flag-tagged
Cat.No. : | AQP1-1221HFL |
Product Overview : | Recombinant Full Length Human AQP1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a small integral membrane protein with six bilayer spanning domains that functions as a water channel protein. This protein permits passive transport of water along an osmotic gradient. This gene is a possible candidate for disorders involving imbalance in ocular fluid movement. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 28.3 kDa |
AA Sequence : | MASEFKKKLFWRAVVAEFLATTLFVFISIGSALGFKYPVGNNQTTVQDNVKVSLAFGLSIATLAQSVGHI SGAHLNPAVTLGLLLSCQISIFRALMYIIAQCVGAIVATAILSGITSSLTGNSLGRNDLADGVNSGQGLG IEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGHLLAIDYTGCGINPARSFGSAVITHNFSNHW IFWVGPFIGGALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Ion Channels: Other, Transmembrane |
Full Length : | Full L. |
Gene Name | AQP1 aquaporin 1 (Colton blood group) [ Homo sapiens (human) ] |
Official Symbol | AQP1 |
Synonyms | CO; CHIP28; AQP-CHIP |
Gene ID | 358 |
mRNA Refseq | NM_198098.4 |
Protein Refseq | NP_932766.1 |
MIM | 107776 |
UniProt ID | P29972 |
◆ Recombinant Proteins | ||
RFL-19910HF | Recombinant Full Length Human Aquaporin-1(Aqp1) (Active) Protein, His-Tagged | +Inquiry |
AQP1-367H | Recombinant Human AQP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
AQP1-0193H | Recombinant Human AQP1 Full Length Transmembrane protein, His-SUMO-tagged | +Inquiry |
Aqp1-1670M | Recombinant Mouse Aqp1 Protein, Myc/DDK-tagged | +Inquiry |
AQP1-1818M | Recombinant Mouse AQP1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
AQP1-8770HCL | Recombinant Human AQP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AQP1 Products
Required fields are marked with *
My Review for All AQP1 Products
Required fields are marked with *
0
Inquiry Basket