Recombinant Full Length Human ARIH2 Protein, C-Flag-tagged
Cat.No. : | ARIH2-1192HFL |
Product Overview : | Recombinant Full Length Human ARIH2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is an E3 ubiquitin-protein ligase that polyubiquitinates some proteins, tagging them for degradation. The encoded protein upregulates p53 in some cancer cells and may inhibit myelopoiesis. Several transcript variants encoding different isoforms have been found for this gene, although the full-length nature of some of them have not been determined yet. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 57.6 kDa |
AA Sequence : | MSVDMNSQGSDSNEEDYDPNCEEEEEEEEDDPGDIEDYYVGVASDVEQQGADAFDPEEYQFTCLTYKESE GALNEHMTSLASVLKVSHSVAKLILVNFHWQVSEILDRYKSNSAQLLVEARVQPNPSKHVPTSHPPHHCA VCMQFVRKENLLSLACQHQFCRSCWEQHCSVLVKDGVGVGVSCMAQDCPLRTPEDFVFPLLPNEELREKY RRYLFRDYVESHYQLQLCPGADCPMVIRVQEPRARRVQCNRCNEVFCFKCRQMYHAPTDCATIRKWLTKC ADDSETANYISAHTKDCPKCNICIEKNGGCNHMQCSKCKHDFCWMCLGDWKTHGSEYYECSRYKENPDIV NQSQQAQAREALKKYLFYFERWENHNKSLQLEAQTYQRIHEKIQERVMNNLGTWIDWQYLQNAAKLLAKC RYTLQYTYPYAYYMESGPRKKLFEYQQAQLEAEIENLSWKVERADSYDRGDLENQMHIAEQRRRTLLKDF HDTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | ARIH2 ariadne RBR E3 ubiquitin protein ligase 2 [ Homo sapiens (human) ] |
Official Symbol | ARIH2 |
Synonyms | ARI2; TRIAD1 |
Gene ID | 10425 |
mRNA Refseq | NM_006321.4 |
Protein Refseq | NP_006312.1 |
MIM | 605615 |
UniProt ID | O95376 |
◆ Recombinant Proteins | ||
ARIH2-4250C | Recombinant Chicken ARIH2 | +Inquiry |
ARIH2-1121HF | Recombinant Full Length Human ARIH2 Protein, GST-tagged | +Inquiry |
ARIH2-800H | Recombinant Human ARIH2 protein, GST-tagged | +Inquiry |
ARIH2-12359Z | Recombinant Zebrafish ARIH2 | +Inquiry |
ARIH2-3441H | Recombinant Human ARIH2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARIH2-8725HCL | Recombinant Human ARIH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARIH2 Products
Required fields are marked with *
My Review for All ARIH2 Products
Required fields are marked with *
0
Inquiry Basket