Recombinant Full Length Human ARMS2 Protein, C-Flag-tagged

• Cat.No.: ARMS2-1932HFL
• Product Overview: Recombinant Full Length Human ARMS2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: This gene encodes a small secreted protein specific to primates. This protein is a component of the choroidal extracellular matrix of the eye. Mutations in this gene are associated with age-related macular degeneration.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 11.3 kDa
• AA Sequence: MLRLYPGPMVTEAEGKGGPEMASLSSSVVPVSFISTLRESVLDPGVGGEGASDKQRSKLSLSHSMIPAAK IHTELCLPAFFSPAGTQRRFQQPQHHLTLSIIHTAAR myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Full Length: Full L.

Gene Information

• Gene Name: ARMS2 age-related maculopathy susceptibility 2 [ Homo sapiens (human) ]
• Official Symbol: ARMS2
• Synonyms: ARMD8
• Gene ID: 387715
• mRNA Refseq: NM_001099667.3
• Protein Refseq: NP_001093137.1
• MIM: 611313
• UniProt ID: P0C7Q2