Recombinant Full Length Human ARPC1B Protein, C-Flag-tagged
Cat.No. : | ARPC1B-2019HFL |
Product Overview : | Recombinant Full Length Human ARPC1B Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes one of seven subunits of the human Arp2/3 protein complex. This subunit is a member of the SOP2 family of proteins and is most similar to the protein encoded by gene ARPC1A. The similarity between these two proteins suggests that they both may function as p41 subunit of the human Arp2/3 complex that has been implicated in the control of actin polymerization in cells. It is possible that the p41 subunit is involved in assembling and maintaining the structure of the Arp2/3 complex. Multiple versions of the p41 subunit may adapt the functions of the complex to different cell types or developmental stages. This protein also has a role in centrosomal homeostasis by being an activator and substrate of the Aurora A kinase. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 40.8 kDa |
AA Sequence : | MAYHSFLVEPISCHAWNKDRTQIAICPNNHEVHIYEKSGAKWTKVHELKEHNGQVTGIDWAPESNRIVTC GTDRNAYVWTLKGRTWKPTLVILRINRAARCVRWAPNENKFAVGSGSRVISICYFEQENDWWVCKHIKKP IRSTVLSLDWHPNNVLLAAGSCDFKCRIFSAYIKEVEERPAPTPWGSKMPFGELMFESSSSCGWVHGVCF SASGSRVAWVSHDSTVCLADADKKMAVATLASETLPLLALTFITDNSLVAAGHDCFPVLFTYDAAAGMLS FGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGM DGGMSIWDVKSLESALKDLKIK myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Fc gamma R-mediated phagocytosis, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton |
Full Length : | Full L. |
Gene Name | ARPC1B actin related protein 2/3 complex subunit 1B [ Homo sapiens (human) ] |
Official Symbol | ARPC1B |
Synonyms | ARC41; IMD71; PLTEID; p40-ARC; p41-ARC |
Gene ID | 10095 |
mRNA Refseq | NM_005720.4 |
Protein Refseq | NP_005711.1 |
MIM | 604223 |
UniProt ID | O15143 |
◆ Recombinant Proteins | ||
ARPC1B-845H | Recombinant Human ARPC1B protein, GST-tagged | +Inquiry |
ARPC1B-12372Z | Recombinant Zebrafish ARPC1B | +Inquiry |
ARPC1B-1258H | Recombinant Human ARPC1B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ARPC1B-748M | Recombinant Mouse ARPC1B Protein, His (Fc)-Avi-tagged | +Inquiry |
ARPC1B-151H | Recombinant Human ARPC1B Protein, DYKDDDDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARPC1B-8686HCL | Recombinant Human ARPC1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARPC1B Products
Required fields are marked with *
My Review for All ARPC1B Products
Required fields are marked with *
0
Inquiry Basket