Recombinant Full Length Human ARSG Protein, C-Flag-tagged
Cat.No. : | ARSG-2059HFL |
Product Overview : | Recombinant Full Length Human ARSG Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene belongs to the sulfatase enzyme family. Sulfatases hydrolyze sulfate esters from sulfated steroids, carbohydrates, proteoglycans, and glycolipids. They are involved in hormone biosynthesis, modulation of cell signaling, and degradation of macromolecules. This protein displays arylsulfatase activity at acidic pH, as is typical of lysosomal sulfatases, and has been shown to localize in the lysosomes. Alternatively spliced transcript variants have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 56.9 kDa |
AA Sequence : | MGWLFLKVLLAGVSFSGFLYPLVDFCISGKTRGQKPNFVIILADDMGWGDLGANWAETKDTANLDKMASE GMRFVDFHAAASTCSPSRASLLTGRLGLRNGVTRNFAVTSVGGLPLNETTLAEVLQQAGYVTGIIGKWHL GHHGSYHPNFRGFDYYFGIPYSHDMGCTDTPGYNHPPCPACPQGDGPSRNLQRDCYTDVALPLYENLNIV EQPVNLSSLAQKYAEKATQFIQRASTSGRPFLLYVALAHMHVPLPVTQLPAAPRGRSLYGAGLWEMDSLV GQIKDKVDHTVKENTFLWFTGDNGPWAQKCELAGSVGPFTGFWQTRQGGSPAKQTTWEGGHRVPALAYWP GRVPVNVTSTALLSVLDIFPTVVALAQASLPQGRRFDGVDVSEVLFGRSQPGHRVLFHPNSGAAGEFGAL QTVRLERYKAFYITGGARACDGSTGPELQHKFPLIFNLEDDTAEAVPLERGGAEYQAVLPEVRKVLADVL QDIANDNISSADYTQDPSVTPCCNPYQIACRCQAA myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Lysosome |
Full Length : | Full L. |
Gene Name | ARSG arylsulfatase G [ Homo sapiens (human) ] |
Official Symbol | ARSG |
Synonyms | USH4 |
Gene ID | 22901 |
mRNA Refseq | NM_014960.5 |
Protein Refseq | NP_055775.2 |
MIM | 610008 |
UniProt ID | Q96EG1 |
◆ Recombinant Proteins | ||
Arsg-574M | Active Recombinant Mouse Arylsulfatase G, His-tagged | +Inquiry |
ARSG-2552H | Recombinant Human ARSG protein, His-SUMO-tagged | +Inquiry |
Arsg-1731M | Recombinant Mouse Arsg Protein, Myc/DDK-tagged | +Inquiry |
ARSG-2059HFL | Recombinant Full Length Human ARSG Protein, C-Flag-tagged | +Inquiry |
ARSG-1172HF | Recombinant Full Length Human ARSG Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARSG-132HCL | Recombinant Human ARSG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARSG Products
Required fields are marked with *
My Review for All ARSG Products
Required fields are marked with *
0
Inquiry Basket