Recombinant Full Length Human ASCL2 Protein, C-Flag-tagged
| Cat.No. : | ASCL2-1467HFL |
| Product Overview : | Recombinant Full Length Human ASCL2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | This gene is a member of the basic helix-loop-helix (BHLH) family of transcription factors. It activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. Involved in the determination of the neuronal precursors in the peripheral nervous system and the central nervous system. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 20 kDa |
| AA Sequence : | MDGGTLPRSAPPAPPVPVGCAARRRPASPELLRCSRRRRPATAETGGGAAAVARRNERERNRVKLVNLGF QALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGLRPQAVRPSAPRGPPGTTPVA ASPSRASSSPGRGGSSEPGSPRSAYSSDDSGCEGALSPAERELLDFSSWLGGYSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Druggable Genome, Transcription Factors |
| Full Length : | Full L. |
| Gene Name | ASCL2 achaete-scute family bHLH transcription factor 2 [ Homo sapiens (human) ] |
| Official Symbol | ASCL2 |
| Synonyms | ASH2; HASH2; MASH2; bHLHa45 |
| Gene ID | 430 |
| mRNA Refseq | NM_005170.3 |
| Protein Refseq | NP_005161.1 |
| MIM | 601886 |
| UniProt ID | Q99929 |
| ◆ Recombinant Proteins | ||
| ASCL2-785M | Recombinant Mouse ASCL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ASCL2-736HF | Recombinant Full Length Human ASCL2 Protein, GST-tagged | +Inquiry |
| ASCL2-906H | Recombinant Human SILV protein, MYC/DDK-tagged | +Inquiry |
| Ascl2-3065M | Recombinant Mouse Ascl2, His-tagged | +Inquiry |
| Ascl2-1740M | Recombinant Mouse Ascl2 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASCL2 Products
Required fields are marked with *
My Review for All ASCL2 Products
Required fields are marked with *
