Recombinant Full Length Human ASS1 Protein, C-Flag-tagged
Cat.No. : | ASS1-463HFL |
Product Overview : | Recombinant Full Length Human ASS1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene catalyzes the penultimate step of the arginine biosynthetic pathway. There are approximately 10 to 14 copies of this gene including the pseudogenes scattered across the human genome, among which the one located on chromosome 9 appears to be the only functional gene for argininosuccinate synthetase. Mutations in the chromosome 9 copy of this gene cause citrullinemia. Two transcript variants encoding the same protein have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 46.3 kDa |
AA Sequence : | MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVFIEDVSREFVE EFIWPAIQSSALYEDRYLLGTSLARPCIARKQVEIAQREGAKYVSHGATGKGNDQVRFELSCYSLAPQIK VIAPWRMPEFYNRFKGRNDLMEYAKQHGIPIPVTPKNPWSMDENLMHISYEAGILENPKNQAPPGLYTKT QDPAKAPNTPDILEIEFKKGVPVKVTNVKDGTTHQTSLELFMYLNEVAGKHGVGRIDIVENRFIGMKSRG IYETPAGTILYHAHLDIEAFTMDREVRKIKQGLGLKFAELVYTGFWHSPECEFVRHCIAKSQERVEGKVQ VSVLKGQVYILGRESPLSLYNEELVSMNVQGDYEPTDATGFININSLRLKEYHRLQSKVTAKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Alanine, aspartate and glutamate metabolism, Arginine and proline metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | ASS1 argininosuccinate synthase 1 [ Homo sapiens (human) ] |
Official Symbol | ASS1 |
Synonyms | ASS; CTLN1 |
Gene ID | 445 |
mRNA Refseq | NM_000050.4 |
Protein Refseq | NP_000041.2 |
MIM | 603470 |
UniProt ID | P00966 |
◆ Recombinant Proteins | ||
ASS1-777H | Recombinant Human Argininosuccinate Synthase 1, His-tagged | +Inquiry |
ASS1-802M | Recombinant Mouse ASS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ASS1-489R | Recombinant Rat ASS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ASS1-1323Z | Recombinant Zebrafish ASS1 | +Inquiry |
ASS1-0626H | Recombinant Human ASS1 Protein (Glu149-Lys412), N-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASS1-8639HCL | Recombinant Human ASS1 293 Cell Lysate | +Inquiry |
ASS1-8640HCL | Recombinant Human ASS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ASS1 Products
Required fields are marked with *
My Review for All ASS1 Products
Required fields are marked with *
0
Inquiry Basket