Recombinant Full Length Human ATG101 Protein, GST-tagged
Cat.No. : | ATG101-1752HF |
Product Overview : | Human C12orf44 full-length ORF ( NP_068753.2, 1 a.a. - 218 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 218 amino acids |
Description : | Enables identical protein binding activity. Involved in autophagosome assembly. Located in phagophore assembly site. |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 51.4 kDa |
AA Sequence : | MNCRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYKKEGTYSIGTVGTQDVDCDFIDFTYVRVSSEELDRALRKVVGEFKDALRNSGGDGLGQMSLEFYQKKKSRWPFSDECIPWEVWTVKVHVVALATEQERQICREKVGEKLCEKIINIVEVMNRHEYLPKMPTQSEVDNVFDTGLRDVQPYLYKISFQITDALGTSVTTTMRRLIKDTLAL |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATG101 autophagy related 101 [ Homo sapiens (human) ] |
Official Symbol | ATG101 |
Synonyms | C12orf44 |
Gene ID | 60673 |
mRNA Refseq | NM_021934.3 |
Protein Refseq | NP_068753.2 |
MIM | 615089 |
UniProt ID | Q9BSB4 |
◆ Recombinant Proteins | ||
ATG101-3496Z | Recombinant Zebrafish ATG101 | +Inquiry |
ATG101-1752HF | Recombinant Full Length Human ATG101 Protein, GST-tagged | +Inquiry |
ATG101-2949H | Recombinant Human ATG101 Protein, His-tagged | +Inquiry |
ATG101-505H | Recombinant Human ATG101 Protein, GST-tagged | +Inquiry |
Atg101-1758M | Recombinant Mouse Atg101 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATG101-8318HCL | Recombinant Human C12orf44 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATG101 Products
Required fields are marked with *
My Review for All ATG101 Products
Required fields are marked with *
0
Inquiry Basket