Recombinant Full Length Human ATG101 Protein, GST-tagged
| Cat.No. : | ATG101-1752HF |
| Product Overview : | Human C12orf44 full-length ORF ( NP_068753.2, 1 a.a. - 218 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 218 amino acids |
| Description : | Enables identical protein binding activity. Involved in autophagosome assembly. Located in phagophore assembly site. |
| Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 51.4 kDa |
| AA Sequence : | MNCRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYKKEGTYSIGTVGTQDVDCDFIDFTYVRVSSEELDRALRKVVGEFKDALRNSGGDGLGQMSLEFYQKKKSRWPFSDECIPWEVWTVKVHVVALATEQERQICREKVGEKLCEKIINIVEVMNRHEYLPKMPTQSEVDNVFDTGLRDVQPYLYKISFQITDALGTSVTTTMRRLIKDTLAL |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ATG101 autophagy related 101 [ Homo sapiens (human) ] |
| Official Symbol | ATG101 |
| Synonyms | C12orf44 |
| Gene ID | 60673 |
| mRNA Refseq | NM_021934.3 |
| Protein Refseq | NP_068753.2 |
| MIM | 615089 |
| UniProt ID | Q9BSB4 |
| ◆ Recombinant Proteins | ||
| ATG101-2949H | Recombinant Human ATG101 Protein, His-tagged | +Inquiry |
| Atg101-1758M | Recombinant Mouse Atg101 Protein, Myc/DDK-tagged | +Inquiry |
| ATG101-3496Z | Recombinant Zebrafish ATG101 | +Inquiry |
| ATG101-5396H | Recombinant Human ATG101 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ATG101-505H | Recombinant Human ATG101 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ATG101-8318HCL | Recombinant Human C12orf44 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATG101 Products
Required fields are marked with *
My Review for All ATG101 Products
Required fields are marked with *
