Recombinant Human ATG101 Protein, GST-tagged

Cat.No. : ATG101-505H
Product Overview : Human C12orf44 full-length ORF ( NP_068753.2, 1 a.a. - 218 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 51.4 kDa
AA Sequence : MNCRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYKKEGTYSIGTVGTQDVDCDFIDFTYVRVSSEELDRALRKVVGEFKDALRNSGGDGLGQMSLEFYQKKKSRWPFSDECIPWEVWTVKVHVVALATEQERQICREKVGEKLCEKIINIVEVMNRHEYLPKMPTQSEVDNVFDTGLRDVQPYLYKISFQITDALGTSVTTTMRRLIKDTLAL
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ATG101 autophagy related 101 [ Homo sapiens (human) ]
Official Symbol ATG101
Synonyms C12orf44
Gene ID 60673
mRNA Refseq NM_021934.3
Protein Refseq NP_068753.2
MIM 615089
UniProt ID Q9BSB4.1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATG101 Products

Required fields are marked with *

My Review for All ATG101 Products

Required fields are marked with *

0
cart-icon
0
compare icon