Recombinant Full Length Human Atp-Sensitive Inward Rectifier Potassium Channel 11(Kcnj11) Protein, His-Tagged
Cat.No. : | RFL23683HF |
Product Overview : | Recombinant Full Length Human ATP-sensitive inward rectifier potassium channel 11(KCNJ11) Protein (Q14654) (1-390aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-390) |
Form : | Lyophilized powder |
AA Sequence : | MLSRKGIIPEEYVLTRLAEDPAEPRYRARQRRARFVSKKGNCNVAHKNIREQGRFLQDVF TTLVDLKWPHTLLIFTMSFLCSWLLFAMAWWLIAFAHGDLAPSEGTAEPCVTSIHSFSSA FLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAET LIFSKHAVIALRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM ENGVGGNSIFLVAPLIIYHVIDANSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQA RTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTIKVPTPLCTARQLDEDHSLLEALT LASARGPLRKRSVPMAKAKPKFSISPDSLS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KCNJ11 |
Synonyms | KCNJ11; ATP-sensitive inward rectifier potassium channel 11; IKATP; Inward rectifier K(+ channel Kir6.2; Potassium channel, inwardly rectifying subfamily J member 11 |
UniProt ID | Q14654 |
◆ Recombinant Proteins | ||
KCNJ11-3196R | Recombinant Rat KCNJ11 Protein | +Inquiry |
RFL14109CF | Recombinant Full Length Guinea Pig Atp-Sensitive Inward Rectifier Potassium Channel 11(Kcnj11) Protein, His-Tagged | +Inquiry |
RFL25622MF | Recombinant Full Length Mouse Atp-Sensitive Inward Rectifier Potassium Channel 11(Kcnj11) Protein, His-Tagged | +Inquiry |
KCNJ11-498H | Recombinant Human KCNJ11 | +Inquiry |
KCNJ11-3666Z | Recombinant Zebrafish KCNJ11 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCNJ11 Products
Required fields are marked with *
My Review for All KCNJ11 Products
Required fields are marked with *