Recombinant Full Length Human ATP5IF1 Protein, C-Flag-tagged

• Cat.No.: ATP5IF1-2056HFL
• Product Overview: Recombinant Full Length Human ATP5IF1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: This gene encodes a mitochondrial ATPase inhibitor. Alternative splicing occurs at this locus and three transcript variants encoding distinct isoforms have been identified.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 9.5 kDa
• AA Sequence: MAVTALAARTWLGVWGVRTMQARGFGSDQSENVDRGAGSIREAGGAFGKREQAEEERYFRAQSREQLAAL KKHHEEEIVHHKKEIERLQKEIERHKQKIKMLKHDD myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Full Length: Full L.

Gene Information

• Gene Name: ATP5IF1 ATP synthase inhibitory factor subunit 1 [ Homo sapiens (human) ]
• Official Symbol: ATP5IF1
• Synonyms: IP; ATPI; ATPIP; ATPIF1
• Gene ID: 93974
• mRNA Refseq: NM_016311.5
• Protein Refseq: NP_057395.1
• MIM: 614981
• UniProt ID: Q9UII2