Recombinant Full Length Human ATP5IF1 Protein, C-Flag-tagged
Cat.No. : | ATP5IF1-2056HFL |
Product Overview : | Recombinant Full Length Human ATP5IF1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a mitochondrial ATPase inhibitor. Alternative splicing occurs at this locus and three transcript variants encoding distinct isoforms have been identified. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 9.5 kDa |
AA Sequence : | MAVTALAARTWLGVWGVRTMQARGFGSDQSENVDRGAGSIREAGGAFGKREQAEEERYFRAQSREQLAAL KKHHEEEIVHHKKEIERLQKEIERHKQKIKMLKHDD myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | ATP5IF1 ATP synthase inhibitory factor subunit 1 [ Homo sapiens (human) ] |
Official Symbol | ATP5IF1 |
Synonyms | IP; ATPI; ATPIP; ATPIF1 |
Gene ID | 93974 |
mRNA Refseq | NM_016311.5 |
Protein Refseq | NP_057395.1 |
MIM | 614981 |
UniProt ID | Q9UII2 |
◆ Recombinant Proteins | ||
ATP5IF1-0109H | Recombinant Human ATP5IF1 Protein (Met1-Asp106), N-GST-tagged | +Inquiry |
ATP5IF1-995H | Recombinant Human ATP5IF1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ATP5IF1-2056HFL | Recombinant Full Length Human ATP5IF1 Protein, C-Flag-tagged | +Inquiry |
ATP5IF1-404H | Recombinant Human ATP5IF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP5IF1-4054H | Recombinant Human ATP5IF1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP5IF1 Products
Required fields are marked with *
My Review for All ATP5IF1 Products
Required fields are marked with *