Recombinant Full Length Human ATP6V1B2 Protein, C-Flag-tagged
Cat.No. : | ATP6V1B2-1223HFL |
Product Overview : | Recombinant Full Length Human ATP6V1B2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. The protein encoded by this gene is one of two V1 domain B subunit isoforms and is the only B isoform highly expressed in osteoclasts. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 56.3 kDa |
AA Sequence : | MALRAMRGIVNGAAPELPVPTGGPAVGAQEQALAVSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAE IVHLTLPDGTKRSGQVLEVSGSKAVVQVFEGTSGIDAKKTSCEFTGDILRTPVSEDMLGRVFNGSGKPID RGPVVLAEDFLDIMGQPINPQCRIYPEEMIRTGISAIDGMNSIARGQKIPIFSAAGLPHNEIAAQICRQA GLVKKSKDVVDYSEENFAIVFAAMGVNMETARFFKSDFEENGSMDNVCLFLNLANDPTIERIITPRLALT TAEFLAYQCEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVGGRNGSITQ IPILTMPNDDITHPIPDLTGYITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHADVSN QLYACYAIGKDVQAMKAVVGEEALTSDDLLYLEFLQKFERNFIAQGPYENRTVFETLDIGWQLLRIFPKE MLKRIPQSTLSEFYPRDSAKHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Epithelial cell signaling in Helicobacter pylori infection, Metabolic pathways, Oxidative phosphorylation, Vibrio cholerae infection |
Full Length : | Full L. |
Gene Name | ATP6V1B2 ATPase H+ transporting V1 subunit B2 [ Homo sapiens (human) ] |
Official Symbol | ATP6V1B2 |
Synonyms | DOOD; HO57; VATB; VPP3; Vma2; ZLS2; ATP6B2; ATP6B1B2 |
Gene ID | 526 |
mRNA Refseq | NM_001693.4 |
Protein Refseq | NP_001684.2 |
MIM | 606939 |
UniProt ID | P21281 |
◆ Recombinant Proteins | ||
ATP6V1B2-9668Z | Recombinant Zebrafish ATP6V1B2 | +Inquiry |
ATP6V1B2-2300H | Recombinant Human ATP6V1B2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ATP6V1B2-1002H | Recombinant Human ATP6V1B2 protein, GST-tagged | +Inquiry |
ATP6V1B2-10042H | Recombinant Human ATP, His-tagged | +Inquiry |
ATP6V1B2-546R | Recombinant Rat ATP6V1B2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP6V1B2-8583HCL | Recombinant Human ATP6V1B2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP6V1B2 Products
Required fields are marked with *
My Review for All ATP6V1B2 Products
Required fields are marked with *
0
Inquiry Basket