Recombinant Full Length Human B-Cell Receptor-Associated Protein 31(Bcap31) Protein, His-Tagged
| Cat.No. : | RFL27674HF |
| Product Overview : | Recombinant Full Length Human B-cell receptor-associated protein 31(BCAP31) Protein (P51572) (2-246aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (2-246) |
| Form : | Lyophilized powder |
| AA Sequence : | SLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVL LVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVT LISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEEN RSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPM DKKEE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | BCAP31 |
| Synonyms | 6C6 AG; 6C6 AG tumor associated antigen; 6C6-AG tumor-associated antigen; 6C6AG; 6C6AG tumor associated antigen; Accessory protein BAP 31; Accessory protein BAP31; B cell receptor associated protein 31; B-cell receptor-associated protein 31; BA31; BAP 31; |
| UniProt ID | P51572 |
| ◆ Recombinant Proteins | ||
| BCAP31-10444Z | Recombinant Zebrafish BCAP31 | +Inquiry |
| BCAP31-10163H | Recombinant Human BCAP31, GST-tagged | +Inquiry |
| BCAP31-118H | Recombinant Human BCAP31 Protein, GST-tagged | +Inquiry |
| BCAP31-119H | Recombinant Human BCAP31 Protein, GST-tagged | +Inquiry |
| Bcap31-1839M | Recombinant Mouse Bcap31 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BCAP31-067HKCL | Human BCAP31 Knockdown Cell Lysate | +Inquiry |
| BCAP31-8499HCL | Recombinant Human BCAP31 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCAP31 Products
Required fields are marked with *
My Review for All BCAP31 Products
Required fields are marked with *


