Recombinant Human BCAP31 Protein, GST-tagged
Cat.No. : | BCAP31-118H |
Product Overview : | Human BCAP31 full-length ORF ( NP_005736.3, 1 a.a. - 246 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the B-cell receptor associated protein 31 superfamily. The encoded protein is a multi-pass transmembrane protein of the endoplasmic reticulum that is involved in the anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi and in the caspase 8-mediated apoptosis. Microdeletions in this gene are associated with the contiguous ABCD1/DXS1375E deletion syndrome. Two pseudogenes have been identified on chromosome 16. Alternatively spliced transcript variants encoding distinct isoforms have been described although the biological validity of some of the variants has not been determined. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 54.4 kDa |
AA Sequence : | MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BCAP31 B-cell receptor-associated protein 31 [ Homo sapiens ] |
Official Symbol | BCAP31 |
Synonyms | BCAP31; B-cell receptor-associated protein 31; 6C6 Ag; BAP31; CDM; DXS1357E; p28 Bap31; BCR-associated protein Bap31; 6C6-AG tumor-associated antigen; 6C6-AG; |
Gene ID | 10134 |
mRNA Refseq | NM_001139441 |
Protein Refseq | NP_001132913 |
MIM | 300398 |
UniProt ID | P51572 |
◆ Recombinant Proteins | ||
BCAP31-1597HF | Recombinant Full Length Human BCAP31 Protein, GST-tagged | +Inquiry |
BCAP31-119H | Recombinant Human BCAP31 Protein, GST-tagged | +Inquiry |
BCAP31-5197H | Recombinant Human BCAP31 protein, GST-tagged | +Inquiry |
BCAP31-118H | Recombinant Human BCAP31 Protein, GST-tagged | +Inquiry |
BCAP31-5103H | Recombinant Human BCAP31 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCAP31-8499HCL | Recombinant Human BCAP31 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCAP31 Products
Required fields are marked with *
My Review for All BCAP31 Products
Required fields are marked with *