Recombinant Full Length Human B-Lymphocyte Antigen Cd20(Ms4A1) Protein, His-Tagged
Cat.No. : | RFL31628HF |
Product Overview : | Recombinant Full Length Human B-lymphocyte antigen CD20(MS4A1) Protein (P11836) (1-297aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-297) |
Form : | Lyophilized powder |
AA Sequence : | MTTPRNSVNGTFPAEPMKGPIAMQSGPKPLFRRMSSLVGPTQSFFMRESKTLGAVQIMNG LFHIALGGLLMIPAGIYAPICVTVWYPLWGGIMYIISGSLLAATEKNSRKCLVKGKMIMN SLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPST QYCYSIQSLFLGILSVMLIFAFFQELVIAGIVENEWKRTCSRPKSNIVLLSAEEKKEQTI EIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MS4A1 |
Synonyms | MS4A1; CD20; B-lymphocyte antigen CD20; B-lymphocyte surface antigen B1; Bp35; Leukocyte surface antigen Leu-16; Membrane-spanning 4-domains subfamily A member 1; CD antigen CD20 |
UniProt ID | P11836 |
◆ Recombinant Proteins | ||
MS4A1-17HA | Recombinant Human MS4A1 protein, Fc-tagged, APC labeled | +Inquiry |
MS4A1-7308HF | Recombinant Human MS4A1 Protein, His-tagged, FITC conjugated | +Inquiry |
MS4A1-11H | Recombinant Human MS4A1 | +Inquiry |
MS4A1-432D | Recombinant Dog MS4A1 protein, His&Myc-tagged | +Inquiry |
MS4A1-3932H | Recombinant Human MS4A1 full length protein, His/Avi-tagged, Biotinylated(Nanodisc) | +Inquiry |
◆ Cell & Tissue Lysates | ||
MS4A1-819CCL | Recombinant Cynomolgus MS4A1 cell lysate | +Inquiry |
MS4A1-1542HCL | Recombinant Human MS4A1 cell lysate | +Inquiry |
MS4A1-1848FCL | Recombinant Ferret MS4A1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MS4A1 Products
Required fields are marked with *
My Review for All MS4A1 Products
Required fields are marked with *
0
Inquiry Basket