Recombinant Full Length Human B9D1 Protein, GST-tagged
Cat.No. : | B9D1-3890HF |
Product Overview : | Human EPPB9 full-length ORF ( AAH02944.1, 1 a.a. - 153 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 153 amino acids |
Description : | This gene encodes a B9 domain-containing protein, one of several that are involved in ciliogenesis. Alterations in expression of this gene have been found in a family with Meckel syndrome. Meckel syndrome has been associated with at least six different genes. This gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq, Mar 2016] |
Molecular Mass : | 43.3 kDa |
AA Sequence : | MATASPSVFLLMVNGQVESAQFPEYDDLYCKYCFVYGQDWAPTAGLEEGISQITSKSQDVRQALVWNFPIDVTFKSTNPYGWPQIVLSVYGPDVFGNDVVRGYGAVHVPFSPGRHKRTIPMFVPESTSKLQKFTSLCLVASSDLQAAPPTEDK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | B9D1 B9 domain containing 1 [ Homo sapiens (human) ] |
Official Symbol | B9D1 |
Synonyms | B9D1; B9 domain containing 1; B9 Domain Containing 1; Endothelial Precursor Protein B9; MKS1-Related Protein 1; B9 Protein Domain 1; MKSR1; B9 Domain-Containing Protein 1; JBTS27; EPPB9; MKS9; B9; B9 domain-containing protein 1; B9 protein domain 1; MKS1-related protein 1; endothelial precursor protein B9 |
Gene ID | 27077 |
mRNA Refseq | NM_001243473 |
Protein Refseq | NP_001230402 |
MIM | 614144 |
UniProt ID | Q9UPM9 |
◆ Recombinant Proteins | ||
B9D1-3890HF | Recombinant Full Length Human B9D1 Protein, GST-tagged | +Inquiry |
B9D1-2988Z | Recombinant Zebrafish B9D1 | +Inquiry |
B9D1-924R | Recombinant Rat B9D1 Protein | +Inquiry |
B9D1-2651H | Recombinant Human B9D1 Protein, GST-tagged | +Inquiry |
B9D1-941M | Recombinant Mouse B9D1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
B9D1-569HCL | Recombinant Human B9D1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All B9D1 Products
Required fields are marked with *
My Review for All B9D1 Products
Required fields are marked with *
0
Inquiry Basket