Recombinant Full Length Human B9D1 Protein, GST-tagged

Cat.No. : B9D1-3890HF
Product Overview : Human EPPB9 full-length ORF ( AAH02944.1, 1 a.a. - 153 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 153 amino acids
Description : This gene encodes a B9 domain-containing protein, one of several that are involved in ciliogenesis. Alterations in expression of this gene have been found in a family with Meckel syndrome. Meckel syndrome has been associated with at least six different genes. This gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq, Mar 2016]
Molecular Mass : 43.3 kDa
AA Sequence : MATASPSVFLLMVNGQVESAQFPEYDDLYCKYCFVYGQDWAPTAGLEEGISQITSKSQDVRQALVWNFPIDVTFKSTNPYGWPQIVLSVYGPDVFGNDVVRGYGAVHVPFSPGRHKRTIPMFVPESTSKLQKFTSLCLVASSDLQAAPPTEDK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name B9D1 B9 domain containing 1 [ Homo sapiens (human) ]
Official Symbol B9D1
Synonyms B9D1; B9 domain containing 1; B9 Domain Containing 1; Endothelial Precursor Protein B9; MKS1-Related Protein 1; B9 Protein Domain 1; MKSR1; B9 Domain-Containing Protein 1; JBTS27; EPPB9; MKS9; B9; B9 domain-containing protein 1; B9 protein domain 1; MKS1-related protein 1; endothelial precursor protein B9
Gene ID 27077
mRNA Refseq NM_001243473
Protein Refseq NP_001230402
MIM 614144
UniProt ID Q9UPM9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All B9D1 Products

Required fields are marked with *

My Review for All B9D1 Products

Required fields are marked with *

0
cart-icon
0
compare icon