Recombinant Full Length Human BAD Protein, C-Flag-tagged
Cat.No. : | BAD-752HFL |
Product Overview : | Recombinant Full Length Human BAD Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the BCL-2 family. BCL-2 family members are known to be regulators of programmed cell death. This protein positively regulates cell apoptosis by forming heterodimers with BCL-xL (B-cell lymphoma-extra large) and BCL-2, and reversing their death repressor activity. Proapoptotic activity of this protein is regulated through its phosphorylation. Protein kinases AKT and MAP kinase, as well as protein phosphatase calcineurin were found to be involved in the regulation of this protein. Alternative splicing of this gene results in two transcript variants which encode the same isoform. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 18.2 kDa |
AA Sequence : | MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIR SRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQ MRQSSSWTRVFQSWWDRNLGRGSSAPSQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Acute myeloid leukemia, Alzheimer's disease, Amyotrophic lateral sclerosis (ALS), Apoptosis, Chronic myeloid leukemia, Colorectal cancer, Endometrial cancer, ErbB signaling pathway, Focal adhesion, Insulin signaling pathway, Melanoma, Neurotrophin signaling pathway, Non-small cell lung cancer, Pancreatic cancer, Pathways in cancer, Prostate cancer, VEGF signaling pathway |
Full Length : | Full L. |
Gene Name | BAD BCL2 associated agonist of cell death [ Homo sapiens (human) ] |
Official Symbol | BAD |
Synonyms | BBC2; BCL2L8 |
Gene ID | 572 |
mRNA Refseq | NM_004322.3 |
Protein Refseq | NP_004313.1 |
MIM | 603167 |
UniProt ID | Q92934 |
◆ Recombinant Proteins | ||
BAD-949M | Recombinant Mouse BAD Protein, His (Fc)-Avi-tagged | +Inquiry |
BAD-419H | Recombinant Human BAD Protein, His (Fc)-Avi-tagged | +Inquiry |
BAD-0222H | Recombinant Human BAD Protein (Met1-Gln168), His-tagged | +Inquiry |
BAD-1767HF | Recombinant Full Length Human BAD Protein, GST-tagged | +Inquiry |
BAD-752HFL | Recombinant Full Length Human BAD Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BAD-8529HCL | Recombinant Human BAD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BAD Products
Required fields are marked with *
My Review for All BAD Products
Required fields are marked with *
0
Inquiry Basket