Recombinant Full Length Human BAMBI Protein, GST-tagged
Cat.No. : | BAMBI-1809HF |
Product Overview : | Human BAMBI full-length ORF ( AAH19252, 1 a.a. - 260 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 260 amino acids |
Description : | This gene encodes a transmembrane glycoprotein related to the type I receptors of the transforming growth factor-beta (TGF-beta) family, whose members play important roles in signal transduction in many developmental and pathological processes. The encoded protein however is a pseudoreceptor, lacking an intracellular serine/threonine kinase domain required for signaling. Similar proteins in frog, mouse and zebrafish function as negative regulators of TGF-beta, which has led to the suggestion that the encoded protein may function to limit the signaling range of the TGF-beta family during early embryogenesis. [provided by RefSeq |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 54.34 kDa |
AA Sequence : | MDRHSSYIFIWLQLELCAMAVLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNSNSPLTHGCLDSLASTTDICQAKQARNHSGTTIPTLECCHEDMCNYRGLHDVLSPPRGEASGQGNRYQHDGSRNLITKVQELTSSKELWFRAAVIAVPIAGGLTLVLLIMLALRMLRSENKRLQDQRQQMLSRLHYSFHGHHSKKGQVAKLDLECMVPVSGHENCCLTCDKMRQADLSNDKILSLVHWGMYSGHGKLEFV |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BAMBI BMP and activin membrane-bound inhibitor homolog (Xenopus laevis) [ Homo sapiens ] |
Official Symbol | BAMBI |
Synonyms | BAMBI; BMP and activin membrane-bound inhibitor homolog (Xenopus laevis); BMP and activin membrane-bound inhibitor homolog; NMA; non-metastatic gene A protein; putative transmembrane protein NMA |
Gene ID | 25805 |
mRNA Refseq | NM_012342 |
Protein Refseq | NP_036474 |
MIM | 604444 |
UniProt ID | Q13145 |
◆ Recombinant Proteins | ||
BAMBI-067H | Recombinant Human BAMBI protein, GST-tagged | +Inquiry |
BAMBI-0133H | Recombinant Human BAMBI Protein (Arg29-Asp130), N-GST-tagged | +Inquiry |
BAMBI-3192H | Recombinant Human BAMBI protein, His-tagged | +Inquiry |
BAMBI-0134H | Recombinant Human BAMBI Protein (Val21-Ala152), C-His-tagged | +Inquiry |
BAMBI-6754H | Recombinant Human BAMBI protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BAMBI-2393HCL | Recombinant Human BAMBI cell lysate | +Inquiry |
BAMBI-1332MCL | Recombinant Mouse BAMBI cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BAMBI Products
Required fields are marked with *
My Review for All BAMBI Products
Required fields are marked with *