Recombinant Full Length Human BAMBI Protein, GST-tagged

Cat.No. : BAMBI-1809HF
Product Overview : Human BAMBI full-length ORF ( AAH19252, 1 a.a. - 260 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 260 amino acids
Description : This gene encodes a transmembrane glycoprotein related to the type I receptors of the transforming growth factor-beta (TGF-beta) family, whose members play important roles in signal transduction in many developmental and pathological processes. The encoded protein however is a pseudoreceptor, lacking an intracellular serine/threonine kinase domain required for signaling. Similar proteins in frog, mouse and zebrafish function as negative regulators of TGF-beta, which has led to the suggestion that the encoded protein may function to limit the signaling range of the TGF-beta family during early embryogenesis. [provided by RefSeq
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 54.34 kDa
AA Sequence : MDRHSSYIFIWLQLELCAMAVLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNSNSPLTHGCLDSLASTTDICQAKQARNHSGTTIPTLECCHEDMCNYRGLHDVLSPPRGEASGQGNRYQHDGSRNLITKVQELTSSKELWFRAAVIAVPIAGGLTLVLLIMLALRMLRSENKRLQDQRQQMLSRLHYSFHGHHSKKGQVAKLDLECMVPVSGHENCCLTCDKMRQADLSNDKILSLVHWGMYSGHGKLEFV
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BAMBI BMP and activin membrane-bound inhibitor homolog (Xenopus laevis) [ Homo sapiens ]
Official Symbol BAMBI
Synonyms BAMBI; BMP and activin membrane-bound inhibitor homolog (Xenopus laevis); BMP and activin membrane-bound inhibitor homolog; NMA; non-metastatic gene A protein; putative transmembrane protein NMA
Gene ID 25805
mRNA Refseq NM_012342
Protein Refseq NP_036474
MIM 604444
UniProt ID Q13145

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BAMBI Products

Required fields are marked with *

My Review for All BAMBI Products

Required fields are marked with *

0
cart-icon