Recombinant Full Length Human BAMBI Protein, GST-tagged

• Cat.No.: BAMBI-1809HF
• Product Overview: Human BAMBI full-length ORF ( AAH19252, 1 a.a. - 260 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 260 amino acids
• Description: This gene encodes a transmembrane glycoprotein related to the type I receptors of the transforming growth factor-beta (TGF-beta) family, whose members play important roles in signal transduction in many developmental and pathological processes. The encoded protein however is a pseudoreceptor, lacking an intracellular serine/threonine kinase domain required for signaling. Similar proteins in frog, mouse and zebrafish function as negative regulators of TGF-beta, which has led to the suggestion that the encoded protein may function to limit the signaling range of the TGF-beta family during early embryogenesis. [provided by RefSeq
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 54.34 kDa
• AA Sequence: MDRHSSYIFIWLQLELCAMAVLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNSNSPLTHGCLDSLASTTDICQAKQARNHSGTTIPTLECCHEDMCNYRGLHDVLSPPRGEASGQGNRYQHDGSRNLITKVQELTSSKELWFRAAVIAVPIAGGLTLVLLIMLALRMLRSENKRLQDQRQQMLSRLHYSFHGHHSKKGQVAKLDLECMVPVSGHENCCLTCDKMRQADLSNDKILSLVHWGMYSGHGKLEFV
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BAMBI BMP and activin membrane-bound inhibitor homolog (Xenopus laevis) [ Homo sapiens ]
• Official Symbol: BAMBI
• Synonyms: BAMBI; BMP and activin membrane-bound inhibitor homolog (Xenopus laevis); BMP and activin membrane-bound inhibitor homolog; NMA; non-metastatic gene A protein; putative transmembrane protein NMA
• Gene ID: 25805
• mRNA Refseq: NM_012342
• Protein Refseq: NP_036474
• MIM: 604444
• UniProt ID: Q13145