Recombinant Full Length Human BANF1 Protein, GST-tagged

Cat.No. : BANF1-1810HF
Product Overview : Human BANF1 full-length ORF ( AAH05942, 1 a.a. - 89 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 89 amino acids
Description : The protein encoded by this gene was first identified by its ability to protect retroviruses from intramolecular integration and therefore promote intermolecular integration into the host cell genome. The protein forms a homodimer which localizes to both the nucleus and cytoplasm and is specifically associated with chromosomes during mitosis. This protein binds to double stranded DNA in a non-specific manner and also binds to LEM-domain containing proteins of the nuclear envelope. This protein is thought to facilitate nuclear reassembly by binding with both DNA and inner nuclear membrane proteins and thereby recruit chromatin to the nuclear periphery. Alternative splicing results in multiple transcript variants encoding the same protein
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 35.53 kDa
AA Sequence : MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BANF1 barrier to autointegration factor 1 [ Homo sapiens ]
Official Symbol BANF1
Synonyms BANF1; barrier to autointegration factor 1; barrier-to-autointegration factor; BAF; breakpoint cluster region protein 1; NGPS; BCRP1; D14S1460; MGC111161
Gene ID 8815
mRNA Refseq NM_001143985
Protein Refseq NP_001137457
MIM 603811
UniProt ID O75531

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BANF1 Products

Required fields are marked with *

My Review for All BANF1 Products

Required fields are marked with *

0
cart-icon
0
compare icon