Recombinant Full Length Human BARX1 Protein, GST-tagged

Cat.No. : BARX1-1818HF
Product Overview : Human BARX1 full-length ORF ( AAH09458, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 100 amino acids
Description : This gene encodes a member of the Bar subclass of homeobox transcription factors. Studies of the mouse and chick homolog suggest the encoded protein may play a role in developing teeth and craniofacial mesenchyme of neural crest origin. The protein may also be associated with differentiation of stomach epithelia. [provided by RefSeq
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : MGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKIVLQGGGLESPTKPKGRPKKNSIPTSEQLTEQERAKDAEKPAEVPGEPSDRSRED
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BARX1 BARX homeobox 1 [ Homo sapiens ]
Official Symbol BARX1
Synonyms BARX1; BARX homeobox 1; BarH like homeobox 1; homeobox protein BarH-like 1; BarH-like homeobox 1
Gene ID 56033
mRNA Refseq NM_021570
Protein Refseq NP_067545
MIM 603260
UniProt ID Q9HBU1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BARX1 Products

Required fields are marked with *

My Review for All BARX1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon