Recombinant Full Length Human BATF Protein, C-Flag-tagged
Cat.No. : | BATF-1447HFL |
Product Overview : | Recombinant Full Length Human BATF Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a nuclear basic leucine zipper protein that belongs to the AP-1/ATF superfamily of transcription factors. The leucine zipper of this protein mediates dimerization with members of the Jun family of proteins. This protein is thought to be a negative regulator of AP-1/ATF transcriptional events. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 13.9 kDa |
AA Sequence : | MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transcription Factors |
Full Length : | Full L. |
Gene Name | BATF basic leucine zipper ATF-like transcription factor [ Homo sapiens (human) ] |
Official Symbol | BATF |
Synonyms | SFA2; B-ATF; BATF1; SFA-2 |
Gene ID | 10538 |
mRNA Refseq | NM_006399.5 |
Protein Refseq | NP_006390.1 |
MIM | 612476 |
UniProt ID | Q16520 |
◆ Recombinant Proteins | ||
BATF-093H | Recombinant Human BATF Protein, GST-tagged | +Inquiry |
BATF-602R | Recombinant Rat BATF Protein, His (Fc)-Avi-tagged | +Inquiry |
BATF-5417H | Recombinant Human BATF Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
BATF-944R | Recombinant Rat BATF Protein | +Inquiry |
BATF-513R | Recombinant Rhesus monkey BATF Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BATF-155HCL | Recombinant Human BATF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BATF Products
Required fields are marked with *
My Review for All BATF Products
Required fields are marked with *