Recombinant Human BATF Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : BATF-5417H
Product Overview : BATF MS Standard C13 and N15-labeled recombinant protein (NP_006390) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a nuclear basic leucine zipper protein that belongs to the AP-1/ATF superfamily of transcription factors. The leucine zipper of this protein mediates dimerization with members of the Jun family of proteins. This protein is thought to be a negative regulator of AP-1/ATF transcriptional events.
Molecular Mass : 14.1 kDa
AA Sequence : MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name BATF basic leucine zipper ATF-like transcription factor [ Homo sapiens (human) ]
Official Symbol BATF
Synonyms BATF; basic leucine zipper transcription factor, ATF-like; basic leucine zipper transcriptional factor ATF-like; activating transcription factor B; B ATF; BATF1; SF HT activated gene 2; SFA 2; SF-HT-activated gene 2 protein; B-cell-activating transcription factor; SFA2; B-ATF; SFA-2;
Gene ID 10538
mRNA Refseq NM_006399
Protein Refseq NP_006390
MIM 612476
UniProt ID Q16520

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BATF Products

Required fields are marked with *

My Review for All BATF Products

Required fields are marked with *

0

Inquiry Basket

cartIcon