Recombinant Human BATF Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | BATF-5417H |
Product Overview : | BATF MS Standard C13 and N15-labeled recombinant protein (NP_006390) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a nuclear basic leucine zipper protein that belongs to the AP-1/ATF superfamily of transcription factors. The leucine zipper of this protein mediates dimerization with members of the Jun family of proteins. This protein is thought to be a negative regulator of AP-1/ATF transcriptional events. |
Molecular Mass : | 14.1 kDa |
AA Sequence : | MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | BATF basic leucine zipper ATF-like transcription factor [ Homo sapiens (human) ] |
Official Symbol | BATF |
Synonyms | BATF; basic leucine zipper transcription factor, ATF-like; basic leucine zipper transcriptional factor ATF-like; activating transcription factor B; B ATF; BATF1; SF HT activated gene 2; SFA 2; SF-HT-activated gene 2 protein; B-cell-activating transcription factor; SFA2; B-ATF; SFA-2; |
Gene ID | 10538 |
mRNA Refseq | NM_006399 |
Protein Refseq | NP_006390 |
MIM | 612476 |
UniProt ID | Q16520 |
◆ Recombinant Proteins | ||
Batf-1825M | Recombinant Mouse Batf Protein, Myc/DDK-tagged | +Inquiry |
BATF-341R | Recombinant Rhesus Macaque BATF Protein, His (Fc)-Avi-tagged | +Inquiry |
BATF-3420H | Recombinant Human BATF, His-tagged | +Inquiry |
BATF-4118Z | Recombinant Zebrafish BATF | +Inquiry |
BATF-513R | Recombinant Rhesus monkey BATF Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BATF-155HCL | Recombinant Human BATF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BATF Products
Required fields are marked with *
My Review for All BATF Products
Required fields are marked with *
0
Inquiry Basket