Recombinant Full Length Human BBC3 Protein, C-Flag-tagged
Cat.No. : | BBC3-558HFL |
Product Overview : | Recombinant Full Length Human BBC3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the BCL-2 family of proteins. This family member belongs to the BH3-only pro-apoptotic subclass. The protein cooperates with direct activator proteins to induce mitochondrial outer membrane permeabilization and apoptosis. It can bind to anti-apoptotic Bcl-2 family members to induce mitochondrial dysfunction and caspase activation. Because of its pro-apoptotic role, this gene is a potential drug target for cancer therapy and for tissue injury. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 20.4 kDa |
AA Sequence : | MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPTLLPAAYLCAPTAPPAVTA ALGGSRWPGGPRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQ LRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Huntington's disease, p53 signaling pathway |
Full Length : | Full L. |
Gene Name | BBC3 BCL2 binding component 3 [ Homo sapiens (human) ] |
Official Symbol | BBC3 |
Synonyms | JFY1; PUMA; JFY-1 |
Gene ID | 27113 |
mRNA Refseq | NM_014417.5 |
Protein Refseq | NP_055232.1 |
MIM | 605854 |
UniProt ID | Q9BXH1 |
◆ Recombinant Proteins | ||
BBC3-562H | Recombinant Human BBC3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
BBC3-26H | Recombinant Human BBC3 protein, His-tagged | +Inquiry |
BBC3-946R | Recombinant Rat BBC3 Protein | +Inquiry |
Bbc3-1958R | Recombinant Rat Bbc3 protein, His & T7-tagged | +Inquiry |
BBC3-604R | Recombinant Rat BBC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BBC3-8505HCL | Recombinant Human BBC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BBC3 Products
Required fields are marked with *
My Review for All BBC3 Products
Required fields are marked with *
0
Inquiry Basket