Recombinant Full Length Human BCAR1 Protein, C-Flag-tagged
Cat.No. : | BCAR1-1108HFL |
Product Overview : | Recombinant Full Length Human BCAR1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the Crk-associated substrate (CAS) family of scaffold proteins, characterized by the presence of multiple protein-protein interaction domains and many serine and tyrosine phosphorylation sites. The encoded protein contains a Src-homology 3 (SH3) domain, a proline-rich domain, a substrate domain which contains 15 repeat of the YxxP consensus phosphorylation motif for Src family kinases, a serine-rich domain, and a bipartite Src-binding domain, which can bind both SH2 and SH3 domains. This adaptor protein functions in multiple cellular pathways, including in cell motility, apoptosis and cell cycle control. Dysregulation of this gene can have a wide range of effects, affecting different pathways, including cardiac development, vascular smooth muscle cells, liver and kidney function, endothelial migration, and cancer. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 93.2 kDa |
AA Sequence : | MNHLNVLAKALYDNVAESPDELSFRKGDIMTVLEQDTQGLDGWWLCSLHGRQGIVPGNRLKILVGMYDKK PAGPGSGPPATPAQPQPGLHAPAPPASQYTPMLPNTYQPQPDSVYLVPTPSKAQQGLYQVPGPSPQFQSP PAKQTSTFSKQTPHHPFPNPATDLYQVPPGPGGPAQDIYQVPPSAGMGHDIYQVPPSMDTRSWEGTKPPA KVVVPTRVGQGYVYEAAQPEQDEYDIPRHLLAPGPQDIYDVPPVRGLLPSQYGQEVYDTPPMAVKGPNGR DPLLEVYDVPPSVEKGLPPSNHHAVYDVPPSVSKDVPDGPLLREETYDVPPAFAKAKPFDPARTPLVLAA PPPDSPPAEDVYDVPPPAPDLYDVPPGLRRPGPGTLYDVPRERVLPPEVADGGVVDSGVYAVPPPAEREA PAEGKRLSASSTGSTRSSQSASSLEVAGPGREPLELEVAVEALARLQQGVSATVAHLLDLAGSAGATGSW RSPSEPQEPLVQDLQAAVAAVQSAVHELLEFARSAVGNAAHTSDRALHAKLSRQLQKMEDVHQTLVAHGQ ALDAGRGGSGATLEDLDRLVACSRAVPEDAKQLASFLHGNASLLFRRTKATAPGPEGGGTLHPNPTDKTS SIQSRPLPSPPKFTSQDSPDGQYENSEGGWMEDYDYVHLQGKEEFEKTQKELLEKGSITRQGKSQLELQQ LKQFERLEQEVSRPIDHDLANWTPAQPLAPGRTGGLGPSDRQLLLFYLEQCEANLTTLTNAVDAFFTAVA TNQPPKIFVAHSKFVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYPSP SAAQDMVERVKELGHSTQQFRRVLGQLAAATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Chemokine signaling pathway, Focal adhesion, Leukocyte transendothelial migration, Regulation of actin cytoskeleton |
Full Length : | Full L. |
Gene Name | BCAR1 BCAR1 scaffold protein, Cas family member [ Homo sapiens (human) ] |
Official Symbol | BCAR1 |
Synonyms | CAS; CAS1; CASS1; CRKAS; P130Cas |
Gene ID | 9564 |
mRNA Refseq | NM_014567.5 |
Protein Refseq | NP_055382.2 |
MIM | 602941 |
UniProt ID | P56945 |
◆ Recombinant Proteins | ||
BCAR1-4521H | Recombinant Human BCAR1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
BCAR1-608R | Recombinant Rat BCAR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BCAR1-430H | Recombinant Human BCAR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BCAR1-121H | Recombinant Human BCAR1 Protein, GST-tagged | +Inquiry |
BCAR1-5042H | Recombinant Human BCAR1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCAR1-8498HCL | Recombinant Human BCAR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCAR1 Products
Required fields are marked with *
My Review for All BCAR1 Products
Required fields are marked with *
0
Inquiry Basket