Recombinant Full Length Human Bcl-2-Like Protein 10(Bcl2L10) Protein, His-Tagged
| Cat.No. : | RFL9328HF | 
| Product Overview : | Recombinant Full Length Human Bcl-2-like protein 10(BCL2L10) Protein (Q9HD36) (1-194aa), fused to N-terminal His tag, was expressed in E. coli. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | Full Length (1-194) | 
| Form : | Lyophilized powder | 
| AA Sequence : | MADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSAYLGY PGNRFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQ EGDVARDCQRLVALLSSRLMGQHRAWLQAQGGWDGFCHFFRTPFPLAFWRKQLVQAFLSC LLTTAFIYLWTRLL | 
| Purity : | Greater than 90% as determined by SDS-PAGE. | 
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 | 
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. | 
| Gene Name | BCL2L10 | 
| Synonyms | BCL2L10; BCLB; Bcl-2-like protein 10; Bcl2-L-10; Anti-apoptotic protein NrH; Apoptosis regulator Bcl-B | 
| UniProt ID | Q9HD36 | 
| ◆ Recombinant Proteins | ||
| BCL2L10-617R | Recombinant Rat BCL2L10 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| BCL2L10-1594HF | Recombinant Full Length Human BCL2L10 Protein, GST-tagged | +Inquiry | 
| BCL2L10-10179H | Recombinant Human BCL2L10, His-tagged | +Inquiry | 
| RFL12110RF | Recombinant Full Length Rat Bcl-2-Like Protein 10(Bcl2L10) Protein, His-Tagged | +Inquiry | 
| RFL9328HF | Recombinant Full Length Human Bcl-2-Like Protein 10(Bcl2L10) Protein, His-Tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| BCL2L10-165HCL | Recombinant Human BCL2L10 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All BCL2L10 Products
Required fields are marked with *
My Review for All BCL2L10 Products
Required fields are marked with *
  
        
    
      
            