Recombinant Full Length Human Bcl-2-Like Protein 10(Bcl2L10) Protein, His-Tagged
| Cat.No. : | RFL9328HF |
| Product Overview : | Recombinant Full Length Human Bcl-2-like protein 10(BCL2L10) Protein (Q9HD36) (1-194aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-194) |
| Form : | Lyophilized powder |
| AA Sequence : | MADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSAYLGY PGNRFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQ EGDVARDCQRLVALLSSRLMGQHRAWLQAQGGWDGFCHFFRTPFPLAFWRKQLVQAFLSC LLTTAFIYLWTRLL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | BCL2L10 |
| Synonyms | BCL2L10; BCLB; Bcl-2-like protein 10; Bcl2-L-10; Anti-apoptotic protein NrH; Apoptosis regulator Bcl-B |
| UniProt ID | Q9HD36 |
| ◆ Recombinant Proteins | ||
| BCL2L10-990M | Recombinant Mouse BCL2L10 Protein, His (Fc)-Avi-tagged | +Inquiry |
| BCL2L10-617R | Recombinant Rat BCL2L10 Protein, His (Fc)-Avi-tagged | +Inquiry |
| BCL2L10-959R | Recombinant Rat BCL2L10 Protein | +Inquiry |
| BCL2L10-148H | Recombinant Human BCL2L10 Protein, GST-tagged | +Inquiry |
| BCL2L10-10179H | Recombinant Human BCL2L10, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BCL2L10-165HCL | Recombinant Human BCL2L10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCL2L10 Products
Required fields are marked with *
My Review for All BCL2L10 Products
Required fields are marked with *



