Recombinant Human BCL2L10 Protein, GST-tagged
Cat.No. : | BCL2L10-148H |
Product Overview : | Human BCL2L10 full-length ORF ( NP_065129.1, 1 a.a. - 204 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The protein encoded by this gene contains conserved BH4, BH1 and BH2 domains. This protein can interact with other members of BCL-2 protein family including BCL2, BCL2L1/BCL-X(L), and BAX. Overexpression of this gene has been shown to suppress cell apoptosis possibly through the prevention of cytochrome C release from the mitochondria, and thus activating caspase-3 activation. The mouse counterpart of this protein is found to interact with Apaf1 and forms a protein complex with Caspase 9, which suggests the involvement of this protein in APAF1 and CASPASE 9 related apoptotic pathway. [provided by RefSeq |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 49.6 kDa |
AA Sequence : | MVDQLRERTTMADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSAYLGYPGNRFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARDCQRLVALLSSRLMGQHRAWLQAQGGWDGFCHFFRTPFPLAFWRKQLVQAFLSCLLTTAFIYLWTRLL |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BCL2L10 BCL2-like 10 (apoptosis facilitator) [ Homo sapiens ] |
Official Symbol | BCL2L10 |
Synonyms | BCL2L10; BCL2-like 10 (apoptosis facilitator); bcl-2-like protein 10; BCL B; Boo; Diva; bcl2-L-10; apoptosis regulator Bcl-B; anti-apoptotic protein NrH; BCL-B; MGC129810; MGC129811; |
Gene ID | 10017 |
mRNA Refseq | NM_020396 |
Protein Refseq | NP_065129 |
MIM | 606910 |
UniProt ID | Q9HD36 |
◆ Recombinant Proteins | ||
BCL2L10-1594HF | Recombinant Full Length Human BCL2L10 Protein, GST-tagged | +Inquiry |
BCL2L10-9748Z | Recombinant Zebrafish BCL2L10 | +Inquiry |
BCL2L10-617R | Recombinant Rat BCL2L10 Protein, His (Fc)-Avi-tagged | +Inquiry |
BCL2L10-7075H | Recombinant Human BCL2L10, His-tagged | +Inquiry |
BCL2L10-10179H | Recombinant Human BCL2L10, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCL2L10-165HCL | Recombinant Human BCL2L10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BCL2L10 Products
Required fields are marked with *
My Review for All BCL2L10 Products
Required fields are marked with *
0
Inquiry Basket