Recombinant Full Length Human BCL2 Protein, C-Flag-tagged
Cat.No. : | BCL2-775HFL |
Product Overview : | Recombinant Full Length Human BCL2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 26.1 kDa |
AA Sequence : | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTS PLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRD GVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLF DFSWLSLKTLLSLALVGACITLGAYLGHKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, ES Cell Differentiation/IPS, Stem cell - Pluripotency, Transmembrane |
Protein Pathways : | Amyotrophic lateral sclerosis (ALS), Apoptosis, Colorectal cancer, Focal adhesion, Neurotrophin signaling pathway, Pathways in cancer, Prostate cancer, Small cell lung cancer |
Full Length : | Full L. |
Gene Name | BCL2 BCL2 apoptosis regulator [ Homo sapiens (human) ] |
Official Symbol | BCL2 |
Synonyms | Bcl-2; PPP1R50 |
Gene ID | 596 |
mRNA Refseq | NM_000633.3 |
Protein Refseq | NP_000624.2 |
MIM | 151430 |
UniProt ID | P10415 |
◆ Recombinant Proteins | ||
BCL216079H | Recombinant Human Bcl-2 (1-201) -delta(46-91) Protein, His-tagged | +Inquiry |
Bcl2-6443M | Recombinant Mouse Bcl2 protein, GST-tagged | +Inquiry |
BCL2-0580H | Recombinant Human BCL2 Protein (Met1-Asp211), C-His-tagged | +Inquiry |
BCL2-4222H | Recombinant Human (minus BH3 domain) B-Cell CLL/Lymphoma 2, His-tagged | +Inquiry |
BCL2-6891C | Recombinant Chicken BCL2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCL2 Products
Required fields are marked with *
My Review for All BCL2 Products
Required fields are marked with *