Recombinant Full Length Human BCL6 Protein, C-Flag-tagged
Cat.No. : | BCL6-305HFL |
Product Overview : | Recombinant Full Length Human BCL6 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a zinc finger transcription factor and contains an N-terminal POZ domain. This protein acts as a sequence-specific repressor of transcription, and has been shown to modulate the transcription of STAT-dependent IL-4 responses of B cells. This protein can interact with a variety of POZ-containing proteins that function as transcription corepressors. This gene is found to be frequently translocated and hypermutated in diffuse large-cell lymphoma (DLCL), and may be involved in the pathogenesis of DLCL. Alternatively spliced transcript variants encoding different protein isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 78.7 kDa |
AA Sequence : | MASPADSCIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKCNLS VINLDPEINPEGFCILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDTCRKFIKASEAEMVSAIKPPR EEFLNSRMLMPQDIMAYRGREVVENNLPLRSAPGCESRAFAPSLYSGLSTPPASYSMYSHLPVSSLLFSD EEFRDVRMPVANPFPKERALPCDSARPVPGEYSRPTLEVSPNVCHSNIYSPKETIPEEARSDMHYSVAEG LKPAAPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSS KNACILQASGSPPAKSPTDPKACNWKKYKFIVLNSLNQNAKPEGPEQAELGRLSPRAYTAPPACQPPMEP ENLDLQSPTKLSASGEDSTIPQASRLNNIVNRSMTGSPRSSSESHSPLYMHPPKCTSCGSQSPQHAEMCL HTAGPTFPEEMGETQSEYSDSSCENGAFFCNECDCRFSEEASLKRHTLQTHSDKPYKCDRCQASFRYKGN LASHKTVHTGEKPYRCNICGAQFNRPANLKTHTRIHSGEKPYKCETCGARFVQVAHLRAHVLIHTGEKPY PCEICGTRFRHLQTLKSHLRIHTGEKPYHCEKCNLHFRHKSQLRLHLRQKHGAITNTKVQYRVSATDLPP ELPKACTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Full Length : | Full L. |
Gene Name | BCL6 BCL6 transcription repressor [ Homo sapiens (human) ] |
Official Symbol | BCL6 |
Synonyms | BCL5; LAZ3; BCL6A; ZNF51; ZBTB27 |
Gene ID | 604 |
mRNA Refseq | NM_001706.5 |
Protein Refseq | NP_001697.2 |
MIM | 109565 |
UniProt ID | P41182 |
◆ Native Proteins | ||
APOB-1H | Native Human Apolipoprotein B | +Inquiry |
GFAP-526H | Native Human GFAP protein | +Inquiry |
Mucin-357 | Native Porcine Mucin protein | +Inquiry |
FGG-53S | Native Sheep Fibrinogen | +Inquiry |
CKM-5306H | Native Human creatine kinase, muscle | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELK3-6629HCL | Recombinant Human ELK3 293 Cell Lysate | +Inquiry |
POLH-1392HCL | Recombinant Human POLH cell lysate | +Inquiry |
PFDN1-3281HCL | Recombinant Human PFDN1 293 Cell Lysate | +Inquiry |
SREK1-1908HCL | Recombinant Human SFRS12 293 Cell Lysate | +Inquiry |
SLC50A1-2548HCL | Recombinant Human RAG1AP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BCL6 Products
Required fields are marked with *
My Review for All BCL6 Products
Required fields are marked with *
0
Inquiry Basket