Recombinant Full Length Human BEST1 Protein, C-Flag-tagged
Cat.No. : | BEST1-1857HFL |
Product Overview : | Recombinant Full Length Human BEST1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the bestrophin gene family. This small gene family is characterized by proteins with a highly conserved N-terminus with four to six transmembrane domains. Bestrophins may form chloride ion channels or may regulate voltage-gated L-type calcium-ion channels. Bestrophins are generally believed to form calcium-activated chloride-ion channels in epithelial cells but they have also been shown to be highly permeable to bicarbonate ion transport in retinal tissue. Mutations in this gene are responsible for juvenile-onset vitelliform macular dystrophy (VMD2), also known as Best macular dystrophy, in addition to adult-onset vitelliform macular dystrophy (AVMD) and other retinopathies. Alternative splicing results in multiple variants encoding distinct isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 67.5 kDa |
AA Sequence : | MTITYTSQVANARLGSFSRLLLCWRGSIYKLLYGEFLIFLLCYYIIRFIYRLALTEEQQLMFEKLTLYCD SYIQLIPISFVLGFYVTLVVTRWWNQYENLPWPDRLMSLVSGFVEGKDEQGRLLRRTLIRYANLGNVLIL RSVSTAVYKRFPSAQHLVQAGFMTPAEHKQLEKLSLPHNMFWVPWVWFANLSMKAWLGGRIRDPILLQSL LNEMNTLRTQCGHLYAYDWISIPLVYTQVVTVAVYSFFLTCLVGRQFLNPAKAYPGHELDLVVPVFTFLQ FFFYVGWLKVAEQLINPFGEDDDDFETNWIVDRNLQVSLLAVDEMHQDLPRMEPDMYWNKPEPQPPYTAA SAQFRRASFMGSTFNISLNKEEMEFQPNQEDEEDAHAGIIGRFLGLQSHDHHPPRANSRTKLLWPKRESL LHEGLPKNHKAAKQNVRGQEDNKAWKLKAVDAFKSAPLYQRPGYYSAPQTPLSPTPMFFPLEPSAPSKLH SVTGIDTKDKSLKTVSSGAKKSFELLSESDGALMEHPEVSQVRRKTVEFNLTDMPEIPENHLKEPLEQSP TNIHTTLKDHMDPYWALENRDEAHS myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Ion Channels: Other, Transmembrane |
Full Length : | Full L. |
Gene Name | BEST1 bestrophin 1 [ Homo sapiens (human) ] |
Official Symbol | BEST1 |
Synonyms | ARB; BMD; BEST; RP50; VMD2; TU15B; Best1V1Delta2 |
Gene ID | 7439 |
mRNA Refseq | NM_004183.4 |
Protein Refseq | NP_004174.1 |
MIM | 607854 |
UniProt ID | O76090 |
◆ Recombinant Proteins | ||
BEST1-90C | Recombinant Cynomolgus Monkey BEST1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BEST1-2376M | Recombinant Mouse BEST1 Protein | +Inquiry |
BEST1-1012M | Recombinant Mouse BEST1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BEST1-1573HF | Recombinant Full Length Human BEST1 Protein, GST-tagged | +Inquiry |
RFL30674MF | Recombinant Full Length Macaca Fascicularis Bestrophin-1(Best1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BEST1-1910HCL | Recombinant Human BEST1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BEST1 Products
Required fields are marked with *
My Review for All BEST1 Products
Required fields are marked with *
0
Inquiry Basket