Recombinant Full Length Human Bestrophin-2(Best2) Protein, His-Tagged
Cat.No. : | RFL25543HF |
Product Overview : | Recombinant Full Length Human Bestrophin-2(BEST2) Protein (Q8NFU1) (1-509aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-509) |
Form : | Lyophilized powder |
AA Sequence : | MTVTYTARVANARFGGFSQLLLLWRGSIYKLLWRELLCFLGFYMALSAAYRFVLTEGQKR YFEKLVIYCDQYASLIPVSFVLGFYVTLVVNRWWSQYLCMPLPDALMCVVAGTVHGRDDR GRLYRRTLMRYAGLSAVLILRSVSTAVFKRFPTIDHVVEAGFMTREERKKFENLNSSYNK YWVPCVWFSNLAAQARREGRIRDNSALKLLLEELNVFRGKCGMLFHYDWISVPLVYTQVV TIALYSYFLACLIGRQFLDPAQGYKDHDLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGE DDDDFETNFLIDRNFQVSMLAVDEMYDDLAVLEKDLYWDAAEARAPYTAATVFQLRQPSF QGSTFDITLAKEDMQFQRLDGLDGPMGEAPGDFLQRLLPAGAGMVAGGPLGRRLSFLLRK NSCVSEASTGASCSCAVVPEGAAPECSCGDPLLDPGLPEPEAPPPAGPEPLTLIPGPVEP FSIVTMPGPRGPAPPWLPSPIGEEEENLA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BEST2 |
Synonyms | BEST2; VMD2L1; Bestrophin-2; Vitelliform macular dystrophy 2-like protein 1 |
UniProt ID | Q8NFU1 |
◆ Recombinant Proteins | ||
BEST2-1013M | Recombinant Mouse BEST2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL25543HF | Recombinant Full Length Human Bestrophin-2(Best2) Protein, His-Tagged | +Inquiry |
BEST2-1714H | Recombinant Human BEST2 protein, His & T7-tagged | +Inquiry |
BEST2-2377M | Recombinant Mouse BEST2 Protein | +Inquiry |
RFL29710MF | Recombinant Full Length Mouse Bestrophin-2(Best2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BEST2-8467HCL | Recombinant Human BEST2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BEST2 Products
Required fields are marked with *
My Review for All BEST2 Products
Required fields are marked with *
0
Inquiry Basket