Recombinant Full Length Human Beta-1,4-Galactosyltransferase 4(B4Galt4) Protein, His-Tagged
| Cat.No. : | RFL30509HF |
| Product Overview : | Recombinant Full Length Human Beta-1,4-galactosyltransferase 4(B4GALT4) Protein (O60513) (1-344aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-344) |
| Form : | Lyophilized powder |
| AA Sequence : | MGFNLTFHLSYKFRLLLLLTLCLTVVGWATSNYFVGAIQEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPQECKALQRVAILVPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLEALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLVVGRNSTGYRLRYSGYFGGVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELQRMKISRPLPEVGKYTMVFHTRDKGNEVNAERMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYINITVDFWFGA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | B4GALT4 |
| Synonyms | B4GALT4; UNQ552/PRO1109; Beta-1,4-galactosyltransferase 4; Beta-1,4-GalTase 4; Beta4Gal-T4; b4Gal-T4; Beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase; Lactotriaosylceramide beta-1,4-galactosyltransferase; N-acetyllactosamine synthase; |
| UniProt ID | O60513 |
| ◆ Recombinant Proteins | ||
| B4GALT4-325R | Recombinant Rhesus Macaque B4GALT4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| B4GALT4-497R | Recombinant Rhesus monkey B4GALT4 Protein, His-tagged | +Inquiry |
| B4galt4-1809M | Recombinant Mouse B4galt4 Protein, Myc/DDK-tagged | +Inquiry |
| B4GALT4-580R | Recombinant Rat B4GALT4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| B4GALT4-0250H | Recombinant Human B4GALT4 Protein (Gln39-Ala344), C-His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| B4GALT4-8537HCL | Recombinant Human B4GALT4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All B4GALT4 Products
Required fields are marked with *
My Review for All B4GALT4 Products
Required fields are marked with *
