Recombinant Full Length Human BIRC2 Protein, C-Flag-tagged
Cat.No. : | BIRC2-954HFL |
Product Overview : | Recombinant Full Length Human BIRC2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of a family of proteins that inhibits apoptosis by binding to tumor necrosis factor receptor-associated factors TRAF1 and TRAF2, probably by interfering with activation of ICE-like proteases. This encoded protein inhibits apoptosis induced by serum deprivation and menadione, a potent inducer of free radicals. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 69.7 kDa |
AA Sequence : | MHKTASQRLFPGPSYQNIKSIMEDSTILSDWTNSNKQKMKYDFSCELYRMSTYSTFPAGVPVSERSLARA GFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLS PTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGFY YIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWP SSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQG RYPHLLEQLLSTSDTTGEENADPPIIHFGPGESSSEDAVMMNTPVVKSALEMGFNRDLVKQTVQSKILTT GENYKTVNDIVSALLNAEDEKREEEKEKQAEEMASDDLSLIRKNRMALFQQLTCVLPILDNLLKANVINK QEHDIIKQKTQIPLQARELIDTILVKGNAAANIFKNCLKEIDSTLYKNLFVDKNMKYIPTEDVSGLSLEE QLRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECAPSLRKCPICRGIIKGTVRTFLSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Apoptosis, Focal adhesion, NOD-like receptor signaling pathway, Pathways in cancer, Small cell lung cancer, Ubiquitin mediated proteolysis |
Full Length : | Full L. |
Gene Name | BIRC2 baculoviral IAP repeat containing 2 [ Homo sapiens (human) ] |
Official Symbol | BIRC2 |
Synonyms | API1; MIHB; HIAP2; RNF48; cIAP1; Hiap-2; c-IAP1 |
Gene ID | 329 |
mRNA Refseq | NM_001166.5 |
Protein Refseq | NP_001157.1 |
MIM | 601712 |
UniProt ID | Q13490 |
◆ Recombinant Proteins | ||
BIRC2-448H | Recombinant Human BIRC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
BIRC2-2587H | Recombinant Human BIRC2 Protein, MYC/DDK-tagged | +Inquiry |
BIRC2-1748C | Recombinant Chicken BIRC2 | +Inquiry |
BIRC2-67H | Recombinant Human BIRC2 protein, GST/StrepII-tagged | +Inquiry |
BIRC2-3104H | Active Recombinant Human Baculoviral IAP Repeat-Containing 2, AVI-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BIRC2-170HCL | Recombinant Human BIRC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BIRC2 Products
Required fields are marked with *
My Review for All BIRC2 Products
Required fields are marked with *
0
Inquiry Basket