Recombinant Full Length Human BLOC1S1 Protein, GST-tagged
| Cat.No. : | BLOC1S1-1710HF |
| Product Overview : | Human BLOC1S1 full-length ORF ( NP_001478.1, 1 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 125 amino acids |
| Description : | BLOC1S1 is a component of the ubiquitously expressed BLOC1 multisubunit protein complex. BLOC1 is required for normal biogenesis of specialized organelles of the endosomal-lysosomal system, such as melanosomes and platelet dense granules (Starcevic and DellAngelica, 2004 [PubMed 15102850]). |
| Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 40.7 kDa |
| AA Sequence : | MLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQLQSAPS |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BLOC1S1 biogenesis of lysosomal organelles complex-1, subunit 1 [ Homo sapiens ] |
| Official Symbol | BLOC1S1 |
| Synonyms | RT14; BLOS1; MICoA; GCN5L1 |
| Gene ID | 2647 |
| mRNA Refseq | NM_001487.3 |
| Protein Refseq | NP_001478.2 |
| MIM | 601444 |
| UniProt ID | P78537 |
| ◆ Recombinant Proteins | ||
| BLOC1S1-1487H | Recombinant Human BLOC1S1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| BLOC1S1-247H | Recombinant Human BLOC1S1 Protein, GST-tagged | +Inquiry |
| BLOC1S1-647R | Recombinant Rat BLOC1S1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Bloc1s1-1872M | Recombinant Mouse Bloc1s1 Protein, Myc/DDK-tagged | +Inquiry |
| BLOC1S1-2418M | Recombinant Mouse BLOC1S1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BLOC1S1-8444HCL | Recombinant Human BLOC1S1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BLOC1S1 Products
Required fields are marked with *
My Review for All BLOC1S1 Products
Required fields are marked with *



