Recombinant Full Length Human BMP8A Protein, GST-tagged

Cat.No. : BMP8A-1729HF
Product Overview : Human BMP8A full-length ORF ( AAH93743.1, 1 a.a. - 116 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 116 amino acids
Description : This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein may play a role in development of the reproductive system. This gene may have arose from a gene duplication event and its gene duplicate is also present on chromosome 1.
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 39.2 kDa
AA Sequence : MNVFKTQTLLCPSGVHSRPEDHDETPFLCSKAQSVTVVAFLVARLLATLATHQMTSHTEGLRKGGGRKDTQLMKGQCSAIKVIFWPGCLPQPRMHSRLHIRSINKGGQLRPTGCNK
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BMP8A bone morphogenetic protein 8a [ Homo sapiens ]
Official Symbol BMP8A
Synonyms BMP8A; bone morphogenetic protein 8a; bone morphogenetic protein 8A; BMP-8A; FLJ14351; FLJ45264
Gene ID 353500
mRNA Refseq NM_181809
Protein Refseq NP_861525
UniProt ID Q7Z5Y6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BMP8A Products

Required fields are marked with *

My Review for All BMP8A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon