Recombinant Full Length Human BMP8A Protein, GST-tagged

• Cat.No.: BMP8A-1729HF
• Product Overview: Human BMP8A full-length ORF ( AAH93743.1, 1 a.a. - 116 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 116 amino acids
• Description: This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein may play a role in development of the reproductive system. This gene may have arose from a gene duplication event and its gene duplicate is also present on chromosome 1.
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 39.2 kDa
• AA Sequence: MNVFKTQTLLCPSGVHSRPEDHDETPFLCSKAQSVTVVAFLVARLLATLATHQMTSHTEGLRKGGGRKDTQLMKGQCSAIKVIFWPGCLPQPRMHSRLHIRSINKGGQLRPTGCNK
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BMP8A bone morphogenetic protein 8a [ Homo sapiens ]
• Official Symbol: BMP8A
• Synonyms: BMP8A; bone morphogenetic protein 8a; bone morphogenetic protein 8A; BMP-8A; FLJ14351; FLJ45264
• Gene ID: 353500
• mRNA Refseq: NM_181809
• Protein Refseq: NP_861525
• UniProt ID: Q7Z5Y6