Recombinant Active Human BMP8A Protein, His-tagged(C-ter)
Cat.No. : | BMP8A-18H |
Product Overview : | Recombinant Active Human BMP8A Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein may play a role in development of the reproductive system. This gene may have arose from a gene duplication event and its gene duplicate is also present on chromosome 1. |
Form : | Powder |
Bio-activity : | Determined by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is 10-19.4 ng/mL. |
AA Sequence : | MAVRPLRRRQPKKSNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMKPNAVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGCH |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 98% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | 20 mM Sodium citrate (pH 3.5) and 0.2 M NaCl. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | BMP8A bone morphogenetic protein 8a [ Homo sapiens ] |
Official Symbol | BMP8A |
Synonyms | BMP8A; bone morphogenetic protein 8a; bone morphogenetic protein 8A; BMP-8A; FLJ14351; FLJ45264; |
Gene ID | 353500 |
mRNA Refseq | NM_181809 |
Protein Refseq | NP_861525 |
UniProt ID | Q7Z5Y6 |
◆ Recombinant Proteins | ||
BMP8A-325H | Recombinant Human BMP8A Protein, His-tagged | +Inquiry |
BMP8A-275H | Recombinant Human BMP8A Protein, GST-tagged | +Inquiry |
BMP8A-017H | Active Recombinant Human BMP8A Protein | +Inquiry |
BMP8A-276H | Recombinant Human BMP8A Protein, GST-tagged | +Inquiry |
BMP8A-1309H | Recombinant Human BMP8A | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BMP8A Products
Required fields are marked with *
My Review for All BMP8A Products
Required fields are marked with *
0
Inquiry Basket