Recombinant Active Human BMP8A Protein, His-tagged(C-ter)

Cat.No. : BMP8A-18H
Product Overview : Recombinant Active Human BMP8A Protein with His tag (C-ter) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein may play a role in development of the reproductive system. This gene may have arose from a gene duplication event and its gene duplicate is also present on chromosome 1.
Form : Powder
Bio-activity : Determined by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is 10-19.4 ng/mL.
AA Sequence : MAVRPLRRRQPKKSNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMKPNAVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGCH
Endotoxin : Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
Purity : > 98% (by SDS-PAGE)
Applications : SDS-PAGE
Notes : For laboratory research only, not for drug, diagnostic or other use.
Storage : Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Storage Buffer : 20 mM Sodium citrate (pH 3.5) and 0.2 M NaCl.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.
Gene Name BMP8A bone morphogenetic protein 8a [ Homo sapiens ]
Official Symbol BMP8A
Synonyms BMP8A; bone morphogenetic protein 8a; bone morphogenetic protein 8A; BMP-8A; FLJ14351; FLJ45264;
Gene ID 353500
mRNA Refseq NM_181809
Protein Refseq NP_861525
UniProt ID Q7Z5Y6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BMP8A Products

Required fields are marked with *

My Review for All BMP8A Products

Required fields are marked with *

0
cart-icon
0
compare icon