Recombinant Full Length Human BMPER Protein, GST-tagged
Cat.No. : | BMPER-1731HF |
Product Overview : | Human BMPER full-length ORF ( NP_597725.1, 1 a.a. - 685 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 685 amino acids |
Description : | This gene encodes a secreted protein that interacts with, and inhibits bone morphogenetic protein (BMP) function. It has been shown to inhibit BMP2- and BMP4-dependent osteoblast differentiation and BMP-dependent differentiation of the chondrogenic cells. Mutations in this gene are associated with a lethal skeletal disorder, diaphanospondylodysostosis. |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 102.4 kDa |
AA Sequence : | MLWFSGVGALAERYCRRSPGITCCVLLLLNCSGVPMSLASSFLTGSVAKCENEGEVLQIPFITDNPCIMCVCLNKEVTCKREKCPVLSRDCALAIKQRGACCEQCKGCTYEGNTYNSSFKWQSPAEPCVLRQCQEGVVTESGVRCVVHCKNPLEHLGMCCPTCPGCVFEGVQYQEGEEFQPEGSKCTKCSCTGGRTQCVREVCPILSCPQHLSHIPPGQCCPKCLGQRKVFDLPFGSCLFRSDVYDNGSSFLYDNCTACTCRDSTVVCKRKCSHPGGCDQGQEGCCEECLLRVPPEDIKVCKFGNKIFQDGEMWSSINCTICACVKGRTECRNKQCIPISSCPQGKILNRKGCCPICTEKPGVCTVFGDPHYNTFDGRTFNFQGTCQYVLTKDCSSPASPFQVLVKNDARRTRSFSWTKSVELVLGESRVSLQQHLTVRWNGSRIALPCRAPHFHIDLDGYLLKVTTKAGLEISWDGDSFVEVMAAPHLKGKLCGLCGNYNGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTVKVKLRAHRECQKLKSWEFQTCHSTVDYATFYRSCVTDMCECPVHKNCYCESFLAYTRACQREGIKVHWEPQQNCAATQCKHGAVYDTCGPGCIKTCDNWNEIGPCNKPCVAGCHCPANLVLHKGRCIKPVLCPQR |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BMPER BMP binding endothelial regulator [ Homo sapiens ] |
Official Symbol | BMPER |
Synonyms | BMPER; BMP binding endothelial regulator; BMP-binding endothelial regulator protein; CRIM3; crossveinless 2; Cv2; hCV2; crossveinless-2; BMP-binding endothelial regulator precursor protein; bone morphogenetic protein-binding endothelial cell precursor-derived regulator; CV2; CV-2 |
Gene ID | 168667 |
mRNA Refseq | NM_133468 |
Protein Refseq | NP_597725 |
MIM | 608699 |
UniProt ID | Q8N8U9 |
◆ Recombinant Proteins | ||
BMPER-2690Z | Recombinant Zebrafish BMPER | +Inquiry |
BMPER-1175H | Recombinant Human BMPER Protein (Ser40-Cys289), N-His tagged | +Inquiry |
Bmper-344M | Active Recombinant Mouse Bmper, His-tagged | +Inquiry |
Bmper-5602M | Active Recombinant Mouse BMP-binding Endothelial Regulator, His-tagged | +Inquiry |
BMPER-2437M | Recombinant Mouse BMPER Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMPER Products
Required fields are marked with *
My Review for All BMPER Products
Required fields are marked with *
0
Inquiry Basket