Recombinant Mouse Bnip3 Full Length Transmembrane protein, His-tagged
Cat.No. : | Bnip3-2354M |
Product Overview : | Recombinant Mouse Bnip3 protein(O55003)(1-187aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-187aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 23.8 kDa |
AA Sequence : | MSQSGEENLQGSWVELHFSNGNGSSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRAEIDSHSFGEKNSTLSEEDYIERRREVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSADFLKVFLPSLLLSHLLAIGLGIYIGRRLTTSTSTF |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Bnip3 BCL2/adenovirus E1B interacting protein 3 [ Mus musculus ] |
Official Symbol | Bnip3 |
Synonyms | BNIP3; BCL2/adenovirus E1B interacting protein 3; BCL2/adenovirus E1B 19 kDa protein-interacting protein 3; BCL2/adenovirus E1B interacting protein 1, NIP3; BCL2/adenovirus E1B 19kDa-interacting protein 1, NIP3; BCL2/adenovirus E1B 19 kDa-interacting protein 1, NIP3; Nip3; |
Gene ID | 12176 |
mRNA Refseq | NM_009760 |
Protein Refseq | NP_033890 |
◆ Recombinant Proteins | ||
BNIP3-3759HF | Recombinant Full Length Human BNIP3 Protein, GST-tagged | +Inquiry |
BNIP3-2403M | Recombinant Mouse BNIP3 Protein (1-156 aa), His-tagged | +Inquiry |
RFL18127MF | Recombinant Full Length Mouse Bcl2/Adenovirus E1B 19 Kda Protein-Interacting Protein 3(Bnip3) Protein, His-Tagged | +Inquiry |
BNIP3-2448M | Recombinant Mouse BNIP3 Protein | +Inquiry |
BNIP3-2001Z | Recombinant Zebrafish BNIP3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
BNIP3-8423HCL | Recombinant Human BNIP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Bnip3 Products
Required fields are marked with *
My Review for All Bnip3 Products
Required fields are marked with *
0
Inquiry Basket