Recombinant Mouse Bnip3 Full Length Transmembrane protein, His-tagged

Cat.No. : Bnip3-2354M
Product Overview : Recombinant Mouse Bnip3 protein(O55003)(1-187aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 1-187aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 23.8 kDa
AA Sequence : MSQSGEENLQGSWVELHFSNGNGSSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRAEIDSHSFGEKNSTLSEEDYIERRREVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSADFLKVFLPSLLLSHLLAIGLGIYIGRRLTTSTSTF
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name Bnip3 BCL2/adenovirus E1B interacting protein 3 [ Mus musculus ]
Official Symbol Bnip3
Synonyms BNIP3; BCL2/adenovirus E1B interacting protein 3; BCL2/adenovirus E1B 19 kDa protein-interacting protein 3; BCL2/adenovirus E1B interacting protein 1, NIP3; BCL2/adenovirus E1B 19kDa-interacting protein 1, NIP3; BCL2/adenovirus E1B 19 kDa-interacting protein 1, NIP3; Nip3;
Gene ID 12176
mRNA Refseq NM_009760
Protein Refseq NP_033890

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Bnip3 Products

Required fields are marked with *

My Review for All Bnip3 Products

Required fields are marked with *

0
cart-icon
0
compare icon