Recombinant Full Length Human BOD1L2 Protein, GST-tagged
Cat.No. : | BOD1L2-4685HF |
Product Overview : | Human FAM44C full-length ORF ( AAH21740.1, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 172 amino acids |
Description : | BOD1L2 (Biorientation Of Chromosomes In Cell Division 1 Like 2) is a Protein Coding gene. An important paralog of this gene is BOD1. |
Molecular Mass : | 44.5 kDa |
AA Sequence : | MADGGGGGSGGAGPASTRASGGGGPINPASLPPGDPQLIAIIVGQLKSRGLFDSFRRDCKADVDTKPAYQNLSQKADNFVSTHLDKQEWNPPANDNQLHDGLRQSVVQSGRSEAGVDRISSQVVDPKLNHIFRPQIEQIIHEFLVAQKEAAVPALPPEPEGQDPPAPSQDTS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BOD1L2 biorientation of chromosomes in cell division 1 like 2 [ Homo sapiens (human) ] |
Official Symbol | BOD1L2 |
Synonyms | BOD1L2; biorientation of chromosomes in cell division 1 like 2; Biorientation Of Chromosomes In Cell Division 1 Like 2; Biorientation Of Chromosomes In Cell Division Protein 1 Pseudogene; Biorientation Of Chromosomes In Cell Division 1 Pseudogene; Family With Sequence Similarity 44, Member C; FAM44C; BOD1P; Putative Biorientation Of Chromosomes In Cell Division Protein 1 Pseudogene; Putative Biorientation Of Chromosomes In Cell Division Protein 1-Like 2; Biorientation Of Chromosomes In Cell Division Protein 1-Like 2; Putative Protein FAM44C; Protein FAM44C; biorientation of chromosomes in cell division protein 1-like 2; biorientation of chromosomes in cell division 1 pseudogene; biorientation of chromosomes in cell division protein 1 pseudogene; family with sequence similarity 44, member C; putative biorientation of chromosomes in cell division protein 1 pseudogene; putative biorientation of chromosomes in cell division protein 1-like 2; putative protein FAM44C |
Gene ID | 284257 |
mRNA Refseq | NM_001257964 |
Protein Refseq | NP_001244893 |
UniProt ID | Q8IYS8 |
◆ Recombinant Proteins | ||
BOD1L2-2554H | Recombinant Human BOD1L2 Protein, His (Fc)-Avi-tagged | +Inquiry |
BOD1L2-4685HF | Recombinant Full Length Human BOD1L2 Protein, GST-tagged | +Inquiry |
BOD1L2-1311H | Recombinant Human BOD1L2 | +Inquiry |
BOD1L2-3763H | Recombinant Human BOD1L2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BOD1L2 Products
Required fields are marked with *
My Review for All BOD1L2 Products
Required fields are marked with *