Recombinant Full Length Human BOD1L2 Protein, GST-tagged

Cat.No. : BOD1L2-4685HF
Product Overview : Human FAM44C full-length ORF ( AAH21740.1, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 172 amino acids
Description : BOD1L2 (Biorientation Of Chromosomes In Cell Division 1 Like 2) is a Protein Coding gene. An important paralog of this gene is BOD1.
Molecular Mass : 44.5 kDa
AA Sequence : MADGGGGGSGGAGPASTRASGGGGPINPASLPPGDPQLIAIIVGQLKSRGLFDSFRRDCKADVDTKPAYQNLSQKADNFVSTHLDKQEWNPPANDNQLHDGLRQSVVQSGRSEAGVDRISSQVVDPKLNHIFRPQIEQIIHEFLVAQKEAAVPALPPEPEGQDPPAPSQDTS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BOD1L2 biorientation of chromosomes in cell division 1 like 2 [ Homo sapiens (human) ]
Official Symbol BOD1L2
Synonyms BOD1L2; biorientation of chromosomes in cell division 1 like 2; Biorientation Of Chromosomes In Cell Division 1 Like 2; Biorientation Of Chromosomes In Cell Division Protein 1 Pseudogene; Biorientation Of Chromosomes In Cell Division 1 Pseudogene; Family With Sequence Similarity 44, Member C; FAM44C; BOD1P; Putative Biorientation Of Chromosomes In Cell Division Protein 1 Pseudogene; Putative Biorientation Of Chromosomes In Cell Division Protein 1-Like 2; Biorientation Of Chromosomes In Cell Division Protein 1-Like 2; Putative Protein FAM44C; Protein FAM44C; biorientation of chromosomes in cell division protein 1-like 2; biorientation of chromosomes in cell division 1 pseudogene; biorientation of chromosomes in cell division protein 1 pseudogene; family with sequence similarity 44, member C; putative biorientation of chromosomes in cell division protein 1 pseudogene; putative biorientation of chromosomes in cell division protein 1-like 2; putative protein FAM44C
Gene ID 284257
mRNA Refseq NM_001257964
Protein Refseq NP_001244893
UniProt ID Q8IYS8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BOD1L2 Products

Required fields are marked with *

My Review for All BOD1L2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon