Recombinant Full Length Human BPIFB1 Protein, C-Flag-tagged
Cat.No. : | BPIFB1-1063HFL |
Product Overview : | Recombinant Full Length Human BPIFB1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene may be involved in the innate immune response to bacterial exposure in the mouth, nasal cavities, and lungs. The encoded protein is secreted and is a member of the BPI/LBP/PLUNC protein superfamily. This gene is found with other members of the superfamily in a cluster on chromosome 20. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 50.2 kDa |
AA Sequence : | MAGPWTFTLLCGLLAATLIQATLSPTAVLILGPKVIKEKLTQELKDHNATSILQQLPLLSAMREKPAGGI PVLGSLVNTVLKHIIWLKVITANILQLQVKPSANDQELLVKIPLDMVAGFNTPLVKTIVEFHMTTEAQAT IRMDTSASGPTRLVLSDCATSHGSLRIQLLHKLSFLVNALAKQVMNLLVPSLPNLVKNQLCPVIEASFNG MYADLLQLVKVPISLSIDRLEFDLLYPAIKGDTIQLYLGAKLLDSQGKVTKWFNNSAASLTMPTLDNIPF SLIVSQDVVKAAVAAVLSPEEFMVLLDSVLPESAHRLKSSIGLINEKAADKLGSTQIVKILTQDTPEFFI DQGHAKVAQLIVLEVFPSSEALRPLFTLGIEASSEAQFYTKGDQLILNLNNISSDRIQLMNSGIGWFQPD VLKNIITEIIHSILLPNQNGKLRSGVPVSLVKALGFEAAESSLTKDALVLTPASLWKPSSPVSQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein, Transmembrane |
Full Length : | Full L. |
Gene Name | BPIFB1 BPI fold containing family B member 1 [ Homo sapiens (human) ] |
Official Symbol | BPIFB1 |
Synonyms | LPLUNC1; C20orf114 |
Gene ID | 92747 |
mRNA Refseq | NM_033197.3 |
Protein Refseq | NP_149974.2 |
UniProt ID | Q8TDL5 |
◆ Recombinant Proteins | ||
BPIFB1-3783H | Recombinant Human BPIFB1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
BPIFB1-211H | Recombinant Human BPIFB1, His tagged | +Inquiry |
BPIFB1-1063HFL | Recombinant Full Length Human BPIFB1 Protein, C-Flag-tagged | +Inquiry |
BPIFB1-1099H | Recombinant Human BPIFB1 protein(Met1-Gln484), His-tagged | +Inquiry |
BPIFB1-1075M | Recombinant Mouse BPIFB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BPIFB1-870HCL | Recombinant Human BPIFB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BPIFB1 Products
Required fields are marked with *
My Review for All BPIFB1 Products
Required fields are marked with *
0
Inquiry Basket