Recombinant Full Length Human BPIFB2 Protein, GST-tagged
Cat.No. : | BPIFB2-3771HF |
Product Overview : | Human BPIL1 full-length ORF ( NP_079503.1, 1 a.a. - 458 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 458 amino acids |
Description : | This gene encodes a member of the lipid transfer/lipopolysaccharide binding protein (LT/LBP) gene family. It is highly expressed in hypertrophic tonsils. This gene and three other members of the LT/LBP gene family form a cluster on the long arm of chromosome 20. |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 75.6 kDa |
AA Sequence : | MAWASRLGLLLALLLPVVGASTPGTVVRLNKAALSYVSEIGKAPLQRALQVTVPHFLDWSGEALQPTRIRILNVHVPRLHLKFIAGFGVRLLAAANFTFKVFRAPEPLELTLPVELLADTRVTQSSIRTPVVSISACSLFSGHANEFDGSNSTSHALLVLVQKHIKAVLSNKLCLSISNLVQGVNVHLGTLIGLNPVGPESQIRYSMVSVPTVTSDYISLEVNAVLFLLGKPIILPTDATPFVLPRHVGTEGSMATVGLSQQLFDSALLLLQKAGALNLDITGQLRSDDNLLNTSALGRLIPEVARQFPEPMPVVLKVRLGATPVAMLHTNNATLRLQPFVEVLATASNSAFQSLFSLDVVVNLRLQLSVSKVKLQGTTSVLGDVQLTVASSNVGFIDTDQVRTLMGTVFEKPLLDHLNALLAMGIALPGVVNLHYVAPEIFVYEGYVVISSGLFYQS |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BPIFB2 BPI fold containing family B, member 2 [ Homo sapiens ] |
Official Symbol | BPIFB2 |
Synonyms | BPIFB2; BPI fold containing family B, member 2; bactericidal/permeability increasing protein like 1 , BPIL1, C20orf184; BPI fold-containing family B member 2; dJ726C3.2; LPLUNC2; BPI-like 1; bactericidal/permeability-increasing protein-like 1; long palate, lung and nasal epithelium carcinoma-associated protein 2; RYSR; BPIL1; C20orf184; |
Gene ID | 80341 |
mRNA Refseq | NM_025227 |
Protein Refseq | NP_079503 |
MIM | 614108 |
UniProt ID | Q8N4F0 |
◆ Recombinant Proteins | ||
BPIFB2-313H | Recombinant Human BPIFB2 Protein, GST-tagged | +Inquiry |
BPIFB2-3771HF | Recombinant Full Length Human BPIFB2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BPIFB2-8416HCL | Recombinant Human BPIL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BPIFB2 Products
Required fields are marked with *
My Review for All BPIFB2 Products
Required fields are marked with *
0
Inquiry Basket