Recombinant Full Length Human BRI3 Protein

Cat.No. : BRI3-3796HF
Product Overview : Human BRI3 full-length ORF (ADR82701.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 757 amino acids
Description : Predicted to enable ribosomal large subunit binding activity. Involved in negative regulation of mitochondrial translation and ribosomal large subunit biogenesis. Located in cytosol and mitochondrion. Colocalizes with mitochondrial large ribosomal subunit.
Form : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Molecular Mass : 13.8 kDa
AA Sequence : MDHKPLLQERPPAYNLEAGQGDYACGPHGYGAIPAAPPPPPYPYLVTGIPTHYPRVYNIHSRTVTRYPANSIVVVGGCPVCRVGVLEDCFTFLGIFLAIILFPFGFICCFALRKRRCPNCGATFA
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name BRI3 brain protein I3 [ Homo sapiens ]
Official Symbol BRI3
Synonyms Brain protein I3; BRI3; BRI3_HUMAN; pRGR2; I3
Gene ID 25798
mRNA Refseq NM_015379.4
Protein Refseq NP_056194.1
MIM 615628
UniProt ID O95415

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BRI3 Products

Required fields are marked with *

My Review for All BRI3 Products

Required fields are marked with *

0
cart-icon
0
compare icon