Recombinant Full Length Human BRI3 Protein
Cat.No. : | BRI3-3796HF |
Product Overview : | Human BRI3 full-length ORF (ADR82701.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 757 amino acids |
Description : | Predicted to enable ribosomal large subunit binding activity. Involved in negative regulation of mitochondrial translation and ribosomal large subunit biogenesis. Located in cytosol and mitochondrion. Colocalizes with mitochondrial large ribosomal subunit. |
Form : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Molecular Mass : | 13.8 kDa |
AA Sequence : | MDHKPLLQERPPAYNLEAGQGDYACGPHGYGAIPAAPPPPPYPYLVTGIPTHYPRVYNIHSRTVTRYPANSIVVVGGCPVCRVGVLEDCFTFLGIFLAIILFPFGFICCFALRKRRCPNCGATFA |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | BRI3 brain protein I3 [ Homo sapiens ] |
Official Symbol | BRI3 |
Synonyms | Brain protein I3; BRI3; BRI3_HUMAN; pRGR2; I3 |
Gene ID | 25798 |
mRNA Refseq | NM_015379.4 |
Protein Refseq | NP_056194.1 |
MIM | 615628 |
UniProt ID | O95415 |
◆ Recombinant Proteins | ||
BRI3-1015R | Recombinant Rat BRI3 Protein | +Inquiry |
BRI3-339H | Recombinant Human BRI3 Protein | +Inquiry |
BRI3-673R | Recombinant Rat BRI3 Protein, His (Fc)-Avi-tagged | +Inquiry |
BRI3-7907Z | Recombinant Zebrafish BRI3 | +Inquiry |
BRI3-565R | Recombinant Rhesus monkey BRI3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BRI3-67HCL | Recombinant Human BRI3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BRI3 Products
Required fields are marked with *
My Review for All BRI3 Products
Required fields are marked with *
0
Inquiry Basket