Recombinant Human BRI3 Protein

Cat.No. : BRI3-339H
Product Overview : Human BRI3 full-length ORF (ADR82701.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Form : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Molecular Mass : 13.8 kDa
AA Sequence : MDHKPLLQERPPAYNLEAGQGDYACGPHGYGAIPAAPPPPPYPYLVTGIPTHYPRVYNIHSRTVTRYPANSIVVVGGCPVCRVGVLEDCFTFLGIFLAIILFPFGFICCFALRKRRCPNCGATFA
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name BRI3 brain protein I3 [ Homo sapiens ]
Official Symbol BRI3
Synonyms Brain protein I3; BRI3; BRI3_HUMAN; pRGR2; I3
Gene ID 25798
mRNA Refseq NM_015379.4
Protein Refseq NP_056194.1
UniProt ID O95415

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BRI3 Products

Required fields are marked with *

My Review for All BRI3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon