Recombinant Human BRI3 Protein
| Cat.No. : | BRI3-339H |
| Product Overview : | Human BRI3 full-length ORF (ADR82701.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Form : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Molecular Mass : | 13.8 kDa |
| AA Sequence : | MDHKPLLQERPPAYNLEAGQGDYACGPHGYGAIPAAPPPPPYPYLVTGIPTHYPRVYNIHSRTVTRYPANSIVVVGGCPVCRVGVLEDCFTFLGIFLAIILFPFGFICCFALRKRRCPNCGATFA |
| Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | BRI3 brain protein I3 [ Homo sapiens ] |
| Official Symbol | BRI3 |
| Synonyms | Brain protein I3; BRI3; BRI3_HUMAN; pRGR2; I3 |
| Gene ID | 25798 |
| mRNA Refseq | NM_015379.4 |
| Protein Refseq | NP_056194.1 |
| UniProt ID | O95415 |
| ◆ Recombinant Proteins | ||
| RFL13168MF | Recombinant Full Length Mouse Brain Protein I3(Bri3) Protein, His-Tagged | +Inquiry |
| BRI3-339H | Recombinant Human BRI3 Protein | +Inquiry |
| BRI3-673R | Recombinant Rat BRI3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL9827HF | Recombinant Full Length Human Brain Protein I3(Bri3) Protein, His-Tagged | +Inquiry |
| BRI3-565R | Recombinant Rhesus monkey BRI3 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BRI3-67HCL | Recombinant Human BRI3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BRI3 Products
Required fields are marked with *
My Review for All BRI3 Products
Required fields are marked with *
