Recombinant Human BRI3 Protein
Cat.No. : | BRI3-339H |
Product Overview : | Human BRI3 full-length ORF (ADR82701.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Form : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Molecular Mass : | 13.8 kDa |
AA Sequence : | MDHKPLLQERPPAYNLEAGQGDYACGPHGYGAIPAAPPPPPYPYLVTGIPTHYPRVYNIHSRTVTRYPANSIVVVGGCPVCRVGVLEDCFTFLGIFLAIILFPFGFICCFALRKRRCPNCGATFA |
Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | BRI3 brain protein I3 [ Homo sapiens ] |
Official Symbol | BRI3 |
Synonyms | Brain protein I3; BRI3; BRI3_HUMAN; pRGR2; I3 |
Gene ID | 25798 |
mRNA Refseq | NM_015379.4 |
Protein Refseq | NP_056194.1 |
UniProt ID | O95415 |
◆ Recombinant Proteins | ||
BRI3-1015R | Recombinant Rat BRI3 Protein | +Inquiry |
BRI3-7907Z | Recombinant Zebrafish BRI3 | +Inquiry |
BRI3-565R | Recombinant Rhesus monkey BRI3 Protein, His-tagged | +Inquiry |
RFL9827HF | Recombinant Full Length Human Brain Protein I3(Bri3) Protein, His-Tagged | +Inquiry |
BRI3-339H | Recombinant Human BRI3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BRI3-67HCL | Recombinant Human BRI3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BRI3 Products
Required fields are marked with *
My Review for All BRI3 Products
Required fields are marked with *